SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091015142m|PACid:23555672 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091015142m|PACid:23555672
Domain Number 1 Region: 942-1090
Classification Level Classification E-value
Superfamily VC0467-like 1.57e-21
Family VC0467-like 0.0021
Further Details:      
 
Domain Number 2 Region: 733-788,819-866
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000025
Family PDI-like 0.032
Further Details:      
 
Weak hits

Sequence:  Phvulv091015142m|PACid:23555672
Domain Number - Region: 645-693
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00419
Family PDI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091015142m|PACid:23555672
Sequence length 1099
Sequence
MKLTSLTVFVIAIASLCILPQYPCSSSSQSQFQWQILTKHNFSSQIRLHNHLLLLVALPW
SGEARSLMNDVSLAVSAKPKEFASLKLMLMHRNTEKVLADSIGATDEITLVYFHYSVSYK
YRGRLRAQNILFSLNPYISLAPEEVPLTALNSPLDLRAFLDSTDKATVLVDFCGWTPKLL
AKSTKDNGTQNSFTVLGNHHGTGLSRGNSRMAVSRGKTNKKVADEDTCKAELGVDKGFCE
APWPGEFTLLNYGLLEGSKDRNHDVVHPCSSSEEFERFHSFYLKFMTVVREFFLPPERNR
FGLVSNRSMLSSLGVGDYGPWFAVQYQAGCSSCSNILKEEDDLNYVLQMNNYCVKELEGN
AYDQEPILPANKPYVLLFVDRSSESSETRGKSKGALEAFRELAQHHHSANQAGKRNNDSD
DKYYHGLKSTSEHPRLKLSMPTQKIKLKEKISSVMIINEGKQVSLDNVPSDLQGSSLNEI
LAYLLQRKNDRKLSSLAKDLGFQLLSDDMDIRLASTQQPYSEVQSNQIPTETSEQGHTDT
VMLDGDPYRSSGEVKENPKSTELSSRHDEVNRPSIISHEEKLSVQPGESVADYELSTAKF
VRSDTDDSSGGNNYEEELTHVLGFKGSFFYSDGNYQLLERLTGGFGVPSLVLVDPIQQQH
YVYPGEKSFNFSSLYDFLSEFLNGTLHPYQRSEYVLRGQKGPIHPPFVNLDFHEIDSIPQ
ITAHSFSELAIGFNHSNKEDTSNAWNKDVLILFSNNWCSFCQRMEMVVREVYRAIKGYVD
MLNRGTQNMEGISDHENFDQVMMKLPVLYLLDCTLNDCDLILKSLDQREVYPALILFPAE
KKKPLLYEGDMAVIGVMKFVAEHGSNFHKLIRDKVAVLWQSERAGKNQNLYDALLTDLNP
ELLQSHSKYHGAPGHDRMLDQVVRPNPMSSPATNGLHEALPHVVIGSVLIATEKLLGVHP
FDASKILIVAANEVTGFQGLILNKHIEWSSLPKLEEELEKLKEAPLSLGGPVMKTGMPLL
SLTRTVSGNHLPEILPGIYLLDQVTTIRKIEELKSANQPVGDYWFFLGYSSWGWKQLHDE
MAEGAWNLSEDATRHLNWP
Download sequence
Identical sequences Phvulv091015142m|PACid:23555672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]