SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Phvulv091027245m|PACid:23540725 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091027245m|PACid:23540725
Domain Number 1 Region: 158-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 2 Region: 261-292
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000353
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 98-130
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000392
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000733
Family CCCH zinc finger 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091027245m|PACid:23540725
Sequence length 295
Sequence
MDTRKRGRLELGFNSNGGFKKSKQEMESLSTGVGSKSKPCTKFFSTSGCPFGEGCHFLHY
VPGGYNAVAHIMNLTPAAPPAPRNVAALPPVPNGSAPSAVKTRICNKFNTAEGCKFGDKC
HFAHGEWELGKHIAPSFDDHRAMGPTASGRFAGRMEPSPGPATSFGSHATAKISVEASLA
GAIIGKGGVNSKQICRQTGAKLSIREHESDPNIRNIELEGNFEQIKEASNMVKDLLLTLQ
MSASSKANQGVPGAPIREHGSNFKTKLCENFSKGSCTFGERCHFAHGAAELRKSV
Download sequence
Identical sequences V7CYE7
XP_007162316.1.22112 XP_007162317.1.22112 Phvulv091027244m|PACid:23540726 Phvulv091027245m|PACid:23540725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]