SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294502125|ref|YP_003566187.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294502125|ref|YP_003566187.1|
Domain Number 1 Region: 20-203
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.18e-46
Family DsbA-like 0.000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294502125|ref|YP_003566187.1|
Sequence length 207
Comment secreted thiol:disulfide interchange protein DsbA [Yersinia pestis Z176003]
Sequence
MKNVWLALVGIVMAFSVTAAQFTDGKQYLTLDKPVTGEPQVLEFFSFYCPHCYQFEEVYQ
VPKAVKKALPEGTKMTRYHVEFLGPLGKQLTQAWAVAMALGVEEKITPLMFEGVQKTQTV
QTPGDIRNVFIKAGISGEDYDAALNSFVVKSLVAQQQKAAEDLQLRGVPAMFVNGKYMIK
NDGMDTSSMDNYVKQYADVVTFLLTQK
Download sequence
Identical sequences A0A0E1NVB9 A0A0H2YDJ4 A0A0H3B929 A0A0M1V1C9 A0A0U1EUJ8 A0A0U1QW99 A0A151CTX1 A0A208RJP4 A0A2A7VL84 Q66GG5 Q9XBV2
gi|186893362|ref|YP_001870474.1| gi|162418848|ref|YP_001604663.1| gi|384124485|ref|YP_005507099.1| gi|108810409|ref|YP_646176.1| gi|22127683|ref|NP_671106.1| gi|45439882|ref|NP_991421.1| gi|384138001|ref|YP_005520703.1| gi|145601127|ref|YP_001165203.1| gi|108809517|ref|YP_653433.1| gi|294502125|ref|YP_003566187.1| gi|218927237|ref|YP_002345112.1| gi|153947881|ref|YP_001399021.1| gi|170026403|ref|YP_001722908.1| gi|384416570|ref|YP_005625932.1| gi|51594375|ref|YP_068566.1| 187410.y3812 214092.YPO0015 229193.YP_0017 273123.YPTB0017 349746.YpAngola_A0022 349747.YpsIP31758_0020 360102.YPA_3526 377628.YPN_0243 386656.YPDSF_3887 502800.YPK_4196 502801.YPTS_0018 WP_002213168.1.100083 WP_002213168.1.100246 WP_002213168.1.100593 WP_002213168.1.100921 WP_002213168.1.100931 WP_002213168.1.10105 WP_002213168.1.101305 WP_002213168.1.101382 WP_002213168.1.101928 WP_002213168.1.102012 WP_002213168.1.102067 WP_002213168.1.10535 WP_002213168.1.10736 WP_002213168.1.10935 WP_002213168.1.10955 WP_002213168.1.11693 WP_002213168.1.11800 WP_002213168.1.12167 WP_002213168.1.12463 WP_002213168.1.12736 WP_002213168.1.12857 WP_002213168.1.1388 WP_002213168.1.14063 WP_002213168.1.14169 WP_002213168.1.14804 WP_002213168.1.15321 WP_002213168.1.15555 WP_002213168.1.15605 WP_002213168.1.15689 WP_002213168.1.16243 WP_002213168.1.16333 WP_002213168.1.17135 WP_002213168.1.17141 WP_002213168.1.17608 WP_002213168.1.17873 WP_002213168.1.17983 WP_002213168.1.18208 WP_002213168.1.18640 WP_002213168.1.18826 WP_002213168.1.19329 WP_002213168.1.19425 WP_002213168.1.19739 WP_002213168.1.20035 WP_002213168.1.20380 WP_002213168.1.20547 WP_002213168.1.2064 WP_002213168.1.20932 WP_002213168.1.21784 WP_002213168.1.21934 WP_002213168.1.22530 WP_002213168.1.22542 WP_002213168.1.22708 WP_002213168.1.23157 WP_002213168.1.23271 WP_002213168.1.23687 WP_002213168.1.23811 WP_002213168.1.24002 WP_002213168.1.2451 WP_002213168.1.25181 WP_002213168.1.25394 WP_002213168.1.26383 WP_002213168.1.2640 WP_002213168.1.26776 WP_002213168.1.26960 WP_002213168.1.27124 WP_002213168.1.27251 WP_002213168.1.2726 WP_002213168.1.28647 WP_002213168.1.28922 WP_002213168.1.29157 WP_002213168.1.29186 WP_002213168.1.29355 WP_002213168.1.2947 WP_002213168.1.29622 WP_002213168.1.2964 WP_002213168.1.29685 WP_002213168.1.29814 WP_002213168.1.3092 WP_002213168.1.30931 WP_002213168.1.311 WP_002213168.1.31336 WP_002213168.1.31496 WP_002213168.1.31721 WP_002213168.1.31739 WP_002213168.1.31805 WP_002213168.1.32343 WP_002213168.1.32446 WP_002213168.1.32736 WP_002213168.1.33203 WP_002213168.1.33324 WP_002213168.1.33661 WP_002213168.1.33775 WP_002213168.1.33937 WP_002213168.1.34031 WP_002213168.1.34138 WP_002213168.1.35389 WP_002213168.1.35538 WP_002213168.1.36088 WP_002213168.1.37174 WP_002213168.1.37494 WP_002213168.1.37863 WP_002213168.1.38147 WP_002213168.1.38235 WP_002213168.1.38532 WP_002213168.1.38743 WP_002213168.1.38824 WP_002213168.1.38993 WP_002213168.1.39066 WP_002213168.1.3976 WP_002213168.1.39858 WP_002213168.1.40071 WP_002213168.1.40134 WP_002213168.1.40534 WP_002213168.1.40853 WP_002213168.1.41196 WP_002213168.1.41984 WP_002213168.1.4210 WP_002213168.1.42361 WP_002213168.1.42490 WP_002213168.1.42976 WP_002213168.1.44408 WP_002213168.1.44598 WP_002213168.1.44603 WP_002213168.1.44832 WP_002213168.1.45198 WP_002213168.1.45214 WP_002213168.1.46262 WP_002213168.1.46545 WP_002213168.1.46697 WP_002213168.1.46731 WP_002213168.1.4678 WP_002213168.1.46891 WP_002213168.1.47387 WP_002213168.1.47440 WP_002213168.1.47769 WP_002213168.1.48166 WP_002213168.1.48722 WP_002213168.1.4889 WP_002213168.1.49315 WP_002213168.1.49906 WP_002213168.1.4997 WP_002213168.1.50010 WP_002213168.1.50093 WP_002213168.1.50106 WP_002213168.1.50185 WP_002213168.1.50984 WP_002213168.1.51284 WP_002213168.1.51293 WP_002213168.1.51588 WP_002213168.1.51772 WP_002213168.1.51934 WP_002213168.1.52158 WP_002213168.1.52247 WP_002213168.1.52473 WP_002213168.1.52734 WP_002213168.1.52792 WP_002213168.1.52819 WP_002213168.1.52969 WP_002213168.1.53300 WP_002213168.1.53838 WP_002213168.1.53848 WP_002213168.1.53953 WP_002213168.1.54568 WP_002213168.1.54951 WP_002213168.1.55194 WP_002213168.1.55695 WP_002213168.1.5592 WP_002213168.1.56031 WP_002213168.1.56912 WP_002213168.1.56953 WP_002213168.1.57585 WP_002213168.1.57657 WP_002213168.1.58067 WP_002213168.1.58543 WP_002213168.1.58794 WP_002213168.1.59102 WP_002213168.1.59431 WP_002213168.1.5957 WP_002213168.1.59635 WP_002213168.1.5968 WP_002213168.1.59687 WP_002213168.1.59789 WP_002213168.1.59885 WP_002213168.1.60437 WP_002213168.1.60707 WP_002213168.1.60896 WP_002213168.1.61689 WP_002213168.1.62232 WP_002213168.1.62342 WP_002213168.1.6270 WP_002213168.1.6333 WP_002213168.1.63387 WP_002213168.1.63641 WP_002213168.1.64142 WP_002213168.1.64474 WP_002213168.1.64780 WP_002213168.1.64786 WP_002213168.1.64910 WP_002213168.1.653 WP_002213168.1.65400 WP_002213168.1.65554 WP_002213168.1.6570 WP_002213168.1.65706 WP_002213168.1.65718 WP_002213168.1.6581 WP_002213168.1.66546 WP_002213168.1.66616 WP_002213168.1.67404 WP_002213168.1.67850 WP_002213168.1.68361 WP_002213168.1.68371 WP_002213168.1.68753 WP_002213168.1.68855 WP_002213168.1.69018 WP_002213168.1.69316 WP_002213168.1.69951 WP_002213168.1.70117 WP_002213168.1.70171 WP_002213168.1.70319 WP_002213168.1.70377 WP_002213168.1.70417 WP_002213168.1.70726 WP_002213168.1.7083 WP_002213168.1.7169 WP_002213168.1.71744 WP_002213168.1.72280 WP_002213168.1.72440 WP_002213168.1.72486 WP_002213168.1.7402 WP_002213168.1.74131 WP_002213168.1.74310 WP_002213168.1.74577 WP_002213168.1.74738 WP_002213168.1.75169 WP_002213168.1.7518 WP_002213168.1.75208 WP_002213168.1.75337 WP_002213168.1.75407 WP_002213168.1.75636 WP_002213168.1.75689 WP_002213168.1.75821 WP_002213168.1.76555 WP_002213168.1.76670 WP_002213168.1.77295 WP_002213168.1.77387 WP_002213168.1.77429 WP_002213168.1.77569 WP_002213168.1.77691 WP_002213168.1.78004 WP_002213168.1.7841 WP_002213168.1.78556 WP_002213168.1.79515 WP_002213168.1.79609 WP_002213168.1.79825 WP_002213168.1.79981 WP_002213168.1.8009 WP_002213168.1.80331 WP_002213168.1.81848 WP_002213168.1.81877 WP_002213168.1.8210 WP_002213168.1.82133 WP_002213168.1.82151 WP_002213168.1.82270 WP_002213168.1.82436 WP_002213168.1.82619 WP_002213168.1.8303 WP_002213168.1.83039 WP_002213168.1.83265 WP_002213168.1.83630 WP_002213168.1.8420 WP_002213168.1.84703 WP_002213168.1.84720 WP_002213168.1.85269 WP_002213168.1.85270 WP_002213168.1.8559 WP_002213168.1.85802 WP_002213168.1.86034 WP_002213168.1.86413 WP_002213168.1.87107 WP_002213168.1.8728 WP_002213168.1.87418 WP_002213168.1.8762 WP_002213168.1.87853 WP_002213168.1.87988 WP_002213168.1.88362 WP_002213168.1.88472 WP_002213168.1.89359 WP_002213168.1.8964 WP_002213168.1.90176 WP_002213168.1.9051 WP_002213168.1.90624 WP_002213168.1.91263 WP_002213168.1.91373 WP_002213168.1.91844 WP_002213168.1.92030 WP_002213168.1.92331 WP_002213168.1.92604 WP_002213168.1.927 WP_002213168.1.9311 WP_002213168.1.9320 WP_002213168.1.93623 WP_002213168.1.93928 WP_002213168.1.93933 WP_002213168.1.94052 WP_002213168.1.94201 WP_002213168.1.94545 WP_002213168.1.94683 WP_002213168.1.95746 WP_002213168.1.95981 WP_002213168.1.97245 WP_002213168.1.97448 WP_002213168.1.97791 WP_002213168.1.97864 WP_002213168.1.97872 WP_002213168.1.97894 WP_002213168.1.99109 WP_002213168.1.99383 WP_002213168.1.9941 WP_002213168.1.99416 WP_002213168.1.99788 WP_002213168.1.99882 WP_002213168.1.99972 WP_002213168.1.99990 YP_002345112.1.25044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]