SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294502431|ref|YP_003566493.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294502431|ref|YP_003566493.1|
Domain Number - Region: 69-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0799
Family Thioltransferase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294502431|ref|YP_003566493.1|
Sequence length 134
Comment hypothetical protein YPZ3_0321 [Yersinia pestis Z176003]
Sequence
MKISTLLTLFPLLMPASVLAGTVLYTDSHHPPINNDASVSVIYLDGPEQLQAQTFGELSS
NPDDAERQAKAVLQSQQWQAHEQELVTVYRAVVRAWELGVTKVPAVVFDDRDVVYGTADV
AQALALRAQSSGGQ
Download sequence
Identical sequences gi|294502431|ref|YP_003566493.1| WP_013060280.1.38147 WP_013060280.1.5592 WP_013060280.1.59687 WP_013060280.1.69316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]