SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294502457|ref|YP_003566519.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294502457|ref|YP_003566519.1|
Domain Number 1 Region: 38-153
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 1.07e-42
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00000929
Further Details:      
 
Domain Number 2 Region: 476-589
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.55e-25
Family Thioltransferase 0.0000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294502457|ref|YP_003566519.1|
Sequence length 595
Comment thiol:disulfide interchange protein [Yersinia pestis Z176003]
Sequence
MAQRFITLILLLCSVLLAPHSAQSSLFGENASFGTKNSQSRFIPVDQAFAFDFHQQGDQL
NLSWQIHPGYYLYRQQIKIVPQQAALGAFTLPEGITHHDEFYGEVEIFKQQLTLKIPITQ
AAEQASVSVTYQGCAEAGFCYPPETRVIPLDVVVAASTASGTAAVNSSATVNPPATTQPE
GDATPVPSTLPFSPLWALLIGIGIAFTPCVLPMYPLISAVILGREKPHSQRRILILAVVY
VQGMALTYTLLGLVVAAAGLQFQAALQHPYVLIGLSVLFVLLALSMFGLYSLQLPSSLQT
RLTQWSNSQRGGSLAGVFAMGALAGLICSPCTTAPLSAILLYIAQSGNMLAGGGTLYLYA
LGMGIPLVVVTLFGNKLIPRSGPWMQYVKEAFGFVILALPVFLLERVLGDVWGLRLWSLL
AVAFFGWAFVLSLKAHAGWVRVCQLLLLAALLIVARPLQDWAFNGNTQQNAVKHINFQPV
ANLPQLQAVLAQAQGKPVMLDLYADWCVACKEFEKYTFSDDKVQRQLANTLLLQADVTAN
NAEHATLLKKFNVLGLPTILFFDSQGNEITAARVTGFMDAAQFLQHLQNTPAVTK
Download sequence
Identical sequences A0A0E1NSZ5 A0A0M1VC60 A0A208S8M8 A4TRR6 Q1C0X4 Q1CEC8 Q8ZIY9
WP_002209121.1.100246 WP_002209121.1.100931 WP_002209121.1.10105 WP_002209121.1.101305 WP_002209121.1.101382 WP_002209121.1.101928 WP_002209121.1.102012 WP_002209121.1.102067 WP_002209121.1.10955 WP_002209121.1.11693 WP_002209121.1.12463 WP_002209121.1.12736 WP_002209121.1.12857 WP_002209121.1.1388 WP_002209121.1.14063 WP_002209121.1.15321 WP_002209121.1.15605 WP_002209121.1.15689 WP_002209121.1.16243 WP_002209121.1.16333 WP_002209121.1.17135 WP_002209121.1.17608 WP_002209121.1.17873 WP_002209121.1.17983 WP_002209121.1.18640 WP_002209121.1.18826 WP_002209121.1.19329 WP_002209121.1.19425 WP_002209121.1.19739 WP_002209121.1.20035 WP_002209121.1.2064 WP_002209121.1.21486 WP_002209121.1.21879 WP_002209121.1.21934 WP_002209121.1.22530 WP_002209121.1.22542 WP_002209121.1.22708 WP_002209121.1.23157 WP_002209121.1.23271 WP_002209121.1.23687 WP_002209121.1.23811 WP_002209121.1.24002 WP_002209121.1.2451 WP_002209121.1.25394 WP_002209121.1.2640 WP_002209121.1.26776 WP_002209121.1.26960 WP_002209121.1.27124 WP_002209121.1.27251 WP_002209121.1.2726 WP_002209121.1.28922 WP_002209121.1.29157 WP_002209121.1.29355 WP_002209121.1.2947 WP_002209121.1.29622 WP_002209121.1.29685 WP_002209121.1.29814 WP_002209121.1.3092 WP_002209121.1.311 WP_002209121.1.31336 WP_002209121.1.31496 WP_002209121.1.31739 WP_002209121.1.31805 WP_002209121.1.32343 WP_002209121.1.32388 WP_002209121.1.32446 WP_002209121.1.33661 WP_002209121.1.33937 WP_002209121.1.34031 WP_002209121.1.35389 WP_002209121.1.35538 WP_002209121.1.36088 WP_002209121.1.37174 WP_002209121.1.37494 WP_002209121.1.37863 WP_002209121.1.38147 WP_002209121.1.38743 WP_002209121.1.38824 WP_002209121.1.38993 WP_002209121.1.39066 WP_002209121.1.39346 WP_002209121.1.3976 WP_002209121.1.40071 WP_002209121.1.40134 WP_002209121.1.40534 WP_002209121.1.40853 WP_002209121.1.41196 WP_002209121.1.4210 WP_002209121.1.42490 WP_002209121.1.44408 WP_002209121.1.44598 WP_002209121.1.44603 WP_002209121.1.44832 WP_002209121.1.45198 WP_002209121.1.45214 WP_002209121.1.46262 WP_002209121.1.46545 WP_002209121.1.46686 WP_002209121.1.46731 WP_002209121.1.4678 WP_002209121.1.46891 WP_002209121.1.47387 WP_002209121.1.48166 WP_002209121.1.48722 WP_002209121.1.4889 WP_002209121.1.49906 WP_002209121.1.4997 WP_002209121.1.50010 WP_002209121.1.50093 WP_002209121.1.50106 WP_002209121.1.51284 WP_002209121.1.51293 WP_002209121.1.51588 WP_002209121.1.51934 WP_002209121.1.52158 WP_002209121.1.52247 WP_002209121.1.52734 WP_002209121.1.52819 WP_002209121.1.52969 WP_002209121.1.53300 WP_002209121.1.53838 WP_002209121.1.53848 WP_002209121.1.53953 WP_002209121.1.54568 WP_002209121.1.54951 WP_002209121.1.55194 WP_002209121.1.55695 WP_002209121.1.5592 WP_002209121.1.56031 WP_002209121.1.56912 WP_002209121.1.56953 WP_002209121.1.57585 WP_002209121.1.57657 WP_002209121.1.58067 WP_002209121.1.58794 WP_002209121.1.59102 WP_002209121.1.59431 WP_002209121.1.5957 WP_002209121.1.59635 WP_002209121.1.59687 WP_002209121.1.59789 WP_002209121.1.60437 WP_002209121.1.60707 WP_002209121.1.60896 WP_002209121.1.62232 WP_002209121.1.62342 WP_002209121.1.63387 WP_002209121.1.64142 WP_002209121.1.64474 WP_002209121.1.64780 WP_002209121.1.64786 WP_002209121.1.64910 WP_002209121.1.653 WP_002209121.1.65400 WP_002209121.1.65554 WP_002209121.1.65706 WP_002209121.1.65718 WP_002209121.1.6581 WP_002209121.1.66118 WP_002209121.1.66546 WP_002209121.1.66616 WP_002209121.1.68361 WP_002209121.1.68753 WP_002209121.1.68855 WP_002209121.1.69018 WP_002209121.1.69316 WP_002209121.1.69951 WP_002209121.1.70117 WP_002209121.1.70171 WP_002209121.1.70319 WP_002209121.1.70377 WP_002209121.1.70417 WP_002209121.1.70726 WP_002209121.1.7083 WP_002209121.1.7169 WP_002209121.1.71744 WP_002209121.1.72280 WP_002209121.1.72440 WP_002209121.1.72486 WP_002209121.1.74577 WP_002209121.1.75173 WP_002209121.1.7518 WP_002209121.1.75407 WP_002209121.1.75636 WP_002209121.1.75689 WP_002209121.1.75821 WP_002209121.1.77387 WP_002209121.1.77429 WP_002209121.1.77691 WP_002209121.1.7841 WP_002209121.1.78556 WP_002209121.1.79515 WP_002209121.1.79550 WP_002209121.1.79609 WP_002209121.1.79981 WP_002209121.1.8009 WP_002209121.1.80331 WP_002209121.1.81848 WP_002209121.1.81877 WP_002209121.1.8210 WP_002209121.1.82133 WP_002209121.1.82151 WP_002209121.1.82270 WP_002209121.1.8303 WP_002209121.1.83265 WP_002209121.1.8420 WP_002209121.1.84703 WP_002209121.1.84720 WP_002209121.1.85269 WP_002209121.1.8559 WP_002209121.1.85802 WP_002209121.1.86034 WP_002209121.1.86413 WP_002209121.1.87418 WP_002209121.1.8762 WP_002209121.1.87853 WP_002209121.1.87988 WP_002209121.1.88362 WP_002209121.1.88472 WP_002209121.1.8964 WP_002209121.1.90176 WP_002209121.1.9051 WP_002209121.1.90624 WP_002209121.1.91844 WP_002209121.1.92030 WP_002209121.1.92331 WP_002209121.1.92604 WP_002209121.1.927 WP_002209121.1.9311 WP_002209121.1.9320 WP_002209121.1.93623 WP_002209121.1.93928 WP_002209121.1.93933 WP_002209121.1.94052 WP_002209121.1.94201 WP_002209121.1.94545 WP_002209121.1.94683 WP_002209121.1.95746 WP_002209121.1.95981 WP_002209121.1.97245 WP_002209121.1.97448 WP_002209121.1.97791 WP_002209121.1.97864 WP_002209121.1.97872 WP_002209121.1.97894 WP_002209121.1.99109 WP_002209121.1.99383 WP_002209121.1.9941 WP_002209121.1.99416 WP_002209121.1.99788 WP_002209121.1.99990 YP_002345423.1.25044 IDP90775 gi|108813485|ref|YP_649252.1| gi|384124770|ref|YP_005507384.1| 187410.y0603 214092.YPO0345 349746.YpAngola_A0728 360102.YPA_3937 377628.YPN_3325 386656.YPDSF_3628 gi|145600875|ref|YP_001164951.1| gi|384413286|ref|YP_005622648.1| gi|384137677|ref|YP_005520379.1| gi|22124516|ref|NP_667939.1| gi|294502457|ref|YP_003566519.1| gi|218927548|ref|YP_002345423.1| gi|162420239|ref|YP_001605305.1| gi|108809927|ref|YP_653843.1| gi|384120892|ref|YP_005503512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]