SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294503611|ref|YP_003567673.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294503611|ref|YP_003567673.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.15e-35
Family Thioltransferase 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294503611|ref|YP_003567673.1|
Sequence length 116
Comment hypothetical protein YPZ3_1501 [Yersinia pestis Z176003]
Sequence
MTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGERFAYVDILQNPDIRAE
LPKYANWPTFPQLWVDGELVGGCDILMEMYQRGELQTLLKETADKYRSQEDQPAAE
Download sequence
Identical sequences A0A0E1NTA6 A0A0E8XFR2 A0A0H2YIY8 A0A0H3B4A7 A0A0M1V629 A0A0T9LI69 A0A0T9PI82 A0A0U1EM88 A0A0U1QX64 A0A208S1L3 Q0WED9 Q66A35
gi|186895676|ref|YP_001872788.1| gi|294503611|ref|YP_003567673.1| gi|162421342|ref|YP_001606980.1| gi|218929474|ref|YP_002347349.1| gi|153948262|ref|YP_001400733.1| gi|384414534|ref|YP_005623896.1| WP_002210946.1.100083 WP_002210946.1.100246 WP_002210946.1.100593 WP_002210946.1.10066 WP_002210946.1.100921 WP_002210946.1.100931 WP_002210946.1.10105 WP_002210946.1.101305 WP_002210946.1.101382 WP_002210946.1.102012 WP_002210946.1.102067 WP_002210946.1.10535 WP_002210946.1.10736 WP_002210946.1.10935 WP_002210946.1.10955 WP_002210946.1.11693 WP_002210946.1.11800 WP_002210946.1.12167 WP_002210946.1.12463 WP_002210946.1.12857 WP_002210946.1.1388 WP_002210946.1.14169 WP_002210946.1.14804 WP_002210946.1.15321 WP_002210946.1.15555 WP_002210946.1.15605 WP_002210946.1.15689 WP_002210946.1.16243 WP_002210946.1.16333 WP_002210946.1.17135 WP_002210946.1.17141 WP_002210946.1.17608 WP_002210946.1.17983 WP_002210946.1.18208 WP_002210946.1.18826 WP_002210946.1.19329 WP_002210946.1.19425 WP_002210946.1.19739 WP_002210946.1.19763 WP_002210946.1.20035 WP_002210946.1.20380 WP_002210946.1.20547 WP_002210946.1.2064 WP_002210946.1.20932 WP_002210946.1.21784 WP_002210946.1.21879 WP_002210946.1.21934 WP_002210946.1.22530 WP_002210946.1.22542 WP_002210946.1.22708 WP_002210946.1.23157 WP_002210946.1.23271 WP_002210946.1.23687 WP_002210946.1.23811 WP_002210946.1.24002 WP_002210946.1.2451 WP_002210946.1.24517 WP_002210946.1.25181 WP_002210946.1.25394 WP_002210946.1.26383 WP_002210946.1.2640 WP_002210946.1.26509 WP_002210946.1.26776 WP_002210946.1.27124 WP_002210946.1.27251 WP_002210946.1.28647 WP_002210946.1.28922 WP_002210946.1.29157 WP_002210946.1.29186 WP_002210946.1.29355 WP_002210946.1.2947 WP_002210946.1.29622 WP_002210946.1.2964 WP_002210946.1.29685 WP_002210946.1.29814 WP_002210946.1.3092 WP_002210946.1.30931 WP_002210946.1.311 WP_002210946.1.31336 WP_002210946.1.31496 WP_002210946.1.31721 WP_002210946.1.31739 WP_002210946.1.31805 WP_002210946.1.32343 WP_002210946.1.32388 WP_002210946.1.32446 WP_002210946.1.32736 WP_002210946.1.33203 WP_002210946.1.33324 WP_002210946.1.33661 WP_002210946.1.33775 WP_002210946.1.33937 WP_002210946.1.34031 WP_002210946.1.34138 WP_002210946.1.35389 WP_002210946.1.35538 WP_002210946.1.36088 WP_002210946.1.37174 WP_002210946.1.37494 WP_002210946.1.38147 WP_002210946.1.38235 WP_002210946.1.38532 WP_002210946.1.38743 WP_002210946.1.38824 WP_002210946.1.38993 WP_002210946.1.39066 WP_002210946.1.39346 WP_002210946.1.3976 WP_002210946.1.39858 WP_002210946.1.40071 WP_002210946.1.40110 WP_002210946.1.40853 WP_002210946.1.41196 WP_002210946.1.41984 WP_002210946.1.4210 WP_002210946.1.42361 WP_002210946.1.42490 WP_002210946.1.42976 WP_002210946.1.44408 WP_002210946.1.44598 WP_002210946.1.44603 WP_002210946.1.44832 WP_002210946.1.45198 WP_002210946.1.45214 WP_002210946.1.46262 WP_002210946.1.46545 WP_002210946.1.46686 WP_002210946.1.46697 WP_002210946.1.46731 WP_002210946.1.4678 WP_002210946.1.46891 WP_002210946.1.47387 WP_002210946.1.47440 WP_002210946.1.47769 WP_002210946.1.47881 WP_002210946.1.48166 WP_002210946.1.48722 WP_002210946.1.4889 WP_002210946.1.49315 WP_002210946.1.49906 WP_002210946.1.4997 WP_002210946.1.50093 WP_002210946.1.50106 WP_002210946.1.50185 WP_002210946.1.50984 WP_002210946.1.51284 WP_002210946.1.51293 WP_002210946.1.51772 WP_002210946.1.51934 WP_002210946.1.52158 WP_002210946.1.52167 WP_002210946.1.52247 WP_002210946.1.52473 WP_002210946.1.52569 WP_002210946.1.52734 WP_002210946.1.52792 WP_002210946.1.52819 WP_002210946.1.52969 WP_002210946.1.53147 WP_002210946.1.53300 WP_002210946.1.53838 WP_002210946.1.53848 WP_002210946.1.53883 WP_002210946.1.53953 WP_002210946.1.54568 WP_002210946.1.54951 WP_002210946.1.55695 WP_002210946.1.5592 WP_002210946.1.56031 WP_002210946.1.56912 WP_002210946.1.56953 WP_002210946.1.57585 WP_002210946.1.57657 WP_002210946.1.58067 WP_002210946.1.58543 WP_002210946.1.58794 WP_002210946.1.59102 WP_002210946.1.59324 WP_002210946.1.59431 WP_002210946.1.5957 WP_002210946.1.5968 WP_002210946.1.59687 WP_002210946.1.59789 WP_002210946.1.59885 WP_002210946.1.60437 WP_002210946.1.60707 WP_002210946.1.60896 WP_002210946.1.61689 WP_002210946.1.62232 WP_002210946.1.62342 WP_002210946.1.6270 WP_002210946.1.6333 WP_002210946.1.63387 WP_002210946.1.63517 WP_002210946.1.63641 WP_002210946.1.64142 WP_002210946.1.64474 WP_002210946.1.64780 WP_002210946.1.64786 WP_002210946.1.64910 WP_002210946.1.653 WP_002210946.1.65400 WP_002210946.1.65554 WP_002210946.1.6570 WP_002210946.1.65706 WP_002210946.1.65718 WP_002210946.1.6581 WP_002210946.1.66118 WP_002210946.1.66546 WP_002210946.1.67404 WP_002210946.1.67850 WP_002210946.1.6791 WP_002210946.1.68371 WP_002210946.1.68753 WP_002210946.1.68855 WP_002210946.1.69018 WP_002210946.1.69316 WP_002210946.1.69951 WP_002210946.1.70117 WP_002210946.1.70171 WP_002210946.1.70319 WP_002210946.1.70377 WP_002210946.1.70417 WP_002210946.1.70726 WP_002210946.1.7083 WP_002210946.1.7169 WP_002210946.1.71744 WP_002210946.1.72280 WP_002210946.1.72440 WP_002210946.1.72486 WP_002210946.1.7402 WP_002210946.1.74131 WP_002210946.1.74310 WP_002210946.1.74577 WP_002210946.1.74738 WP_002210946.1.75169 WP_002210946.1.75173 WP_002210946.1.7518 WP_002210946.1.75208 WP_002210946.1.75337 WP_002210946.1.75407 WP_002210946.1.75636 WP_002210946.1.75689 WP_002210946.1.75821 WP_002210946.1.76555 WP_002210946.1.76670 WP_002210946.1.77295 WP_002210946.1.77387 WP_002210946.1.77429 WP_002210946.1.77569 WP_002210946.1.77691 WP_002210946.1.78004 WP_002210946.1.7841 WP_002210946.1.78556 WP_002210946.1.7939 WP_002210946.1.79515 WP_002210946.1.79550 WP_002210946.1.79609 WP_002210946.1.79825 WP_002210946.1.8009 WP_002210946.1.81848 WP_002210946.1.81877 WP_002210946.1.8210 WP_002210946.1.82133 WP_002210946.1.82270 WP_002210946.1.82436 WP_002210946.1.82619 WP_002210946.1.8303 WP_002210946.1.83039 WP_002210946.1.83102 WP_002210946.1.83265 WP_002210946.1.83630 WP_002210946.1.8420 WP_002210946.1.84703 WP_002210946.1.84720 WP_002210946.1.85269 WP_002210946.1.85270 WP_002210946.1.85802 WP_002210946.1.86034 WP_002210946.1.86059 WP_002210946.1.86413 WP_002210946.1.87107 WP_002210946.1.8728 WP_002210946.1.87418 WP_002210946.1.8762 WP_002210946.1.87853 WP_002210946.1.87988 WP_002210946.1.88362 WP_002210946.1.88472 WP_002210946.1.89359 WP_002210946.1.89542 WP_002210946.1.8964 WP_002210946.1.90176 WP_002210946.1.9051 WP_002210946.1.90624 WP_002210946.1.91263 WP_002210946.1.91373 WP_002210946.1.91844 WP_002210946.1.92030 WP_002210946.1.92331 WP_002210946.1.92604 WP_002210946.1.927 WP_002210946.1.9311 WP_002210946.1.9320 WP_002210946.1.93623 WP_002210946.1.93928 WP_002210946.1.93933 WP_002210946.1.94052 WP_002210946.1.94201 WP_002210946.1.94545 WP_002210946.1.94683 WP_002210946.1.95746 WP_002210946.1.95981 WP_002210946.1.97245 WP_002210946.1.97375 WP_002210946.1.97791 WP_002210946.1.97864 WP_002210946.1.97872 WP_002210946.1.97894 WP_002210946.1.99109 WP_002210946.1.99383 WP_002210946.1.9941 WP_002210946.1.99416 WP_002210946.1.99788 WP_002210946.1.99882 WP_002210946.1.99972 WP_002210946.1.99990 YP_002347349.1.25044 gi|108812000|ref|YP_647767.1| gi|384125942|ref|YP_005508556.1| gi|108807724|ref|YP_651640.1| gi|145598066|ref|YP_001162142.1| gi|51596621|ref|YP_070812.1| gi|384122058|ref|YP_005504678.1| gi|170024105|ref|YP_001720610.1| gi|384139789|ref|YP_005522491.1| 214092.YPO2383 273123.YPTB2297 349746.YpAngola_A2569 349747.YpsIP31758_1758 360102.YPA_1729 377628.YPN_1838 386656.YPDSF_0763 502800.YPK_1866 502801.YPTS_2370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]