SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294503645|ref|YP_003567707.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294503645|ref|YP_003567707.1|
Domain Number 1 Region: 4-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-44
Family Glutathione peroxidase-like 0.00000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294503645|ref|YP_003567707.1|
Sequence length 167
Comment thiol peroxidase [Yersinia pestis Z176003]
Sequence
MTQTVHFQGNPVSVAGKLPQIGDKAKDFTLVAKDLSDVALSSFAGKRKVLNIFPSIDTGV
CAASVRKFNQLAGELENTVVLCISSDLPFAQSRFCGAEGLSNVITLSTLRGADFKQAYGV
AITEGPLAGLTARAVVVLDGQDNVIYSELVNEITTEPNYDAALAALK
Download sequence
Identical sequences A0A0E1NVR4 A0A0H2YIS6 A0A0H3B2F9 A0A0M1V5T4 A0A0U1EM47 A0A0U1R1V3 A0A154LXV7 A0A208RU56 Q66A71 Q8ZE42
gi|145598106|ref|YP_001162182.1| gi|384122093|ref|YP_005504713.1| gi|384414496|ref|YP_005623858.1| 000423307|e2xpdB1|2485.1.1.34|B:34-200 000423309|e2xpdD1|2485.1.1.34|D:34-200 000423310|e2xpdE1|2485.1.1.34|E:34-200 cath|current|2xpdB00/1-167 cath|current|2xpdD00/1-167 cath|current|2xpdE00/1-167 d2xpdb_ d2xpdc1 d2xpdd_ d2xpde_ d3zrda1 gi|294503645|ref|YP_003567707.1| gi|161484811|ref|NP_669305.2| gi|153950251|ref|YP_001400770.1| gi|161511374|ref|NP_993461.2| WP_002210984.1.100083 WP_002210984.1.100246 WP_002210984.1.100593 WP_002210984.1.10066 WP_002210984.1.100921 WP_002210984.1.100931 WP_002210984.1.10105 WP_002210984.1.101305 WP_002210984.1.101382 WP_002210984.1.101928 WP_002210984.1.102012 WP_002210984.1.102067 WP_002210984.1.10736 WP_002210984.1.10935 WP_002210984.1.10955 WP_002210984.1.11693 WP_002210984.1.12167 WP_002210984.1.12463 WP_002210984.1.12736 WP_002210984.1.12857 WP_002210984.1.1388 WP_002210984.1.14063 WP_002210984.1.14169 WP_002210984.1.14804 WP_002210984.1.15321 WP_002210984.1.15555 WP_002210984.1.15605 WP_002210984.1.15689 WP_002210984.1.16243 WP_002210984.1.16333 WP_002210984.1.17135 WP_002210984.1.17141 WP_002210984.1.17608 WP_002210984.1.17873 WP_002210984.1.17983 WP_002210984.1.18208 WP_002210984.1.18640 WP_002210984.1.18826 WP_002210984.1.19329 WP_002210984.1.19425 WP_002210984.1.19739 WP_002210984.1.19763 WP_002210984.1.20035 WP_002210984.1.20380 WP_002210984.1.2064 WP_002210984.1.20932 WP_002210984.1.21486 WP_002210984.1.21784 WP_002210984.1.21879 WP_002210984.1.21934 WP_002210984.1.22530 WP_002210984.1.22542 WP_002210984.1.22708 WP_002210984.1.23157 WP_002210984.1.23271 WP_002210984.1.23687 WP_002210984.1.23811 WP_002210984.1.24002 WP_002210984.1.2451 WP_002210984.1.24517 WP_002210984.1.25181 WP_002210984.1.25394 WP_002210984.1.26383 WP_002210984.1.2640 WP_002210984.1.26776 WP_002210984.1.26960 WP_002210984.1.27124 WP_002210984.1.27251 WP_002210984.1.2726 WP_002210984.1.28647 WP_002210984.1.28922 WP_002210984.1.29157 WP_002210984.1.29186 WP_002210984.1.29355 WP_002210984.1.2947 WP_002210984.1.29622 WP_002210984.1.2964 WP_002210984.1.29685 WP_002210984.1.29814 WP_002210984.1.3092 WP_002210984.1.30931 WP_002210984.1.311 WP_002210984.1.31336 WP_002210984.1.31496 WP_002210984.1.31721 WP_002210984.1.31739 WP_002210984.1.31805 WP_002210984.1.32343 WP_002210984.1.32446 WP_002210984.1.32736 WP_002210984.1.33203 WP_002210984.1.33324 WP_002210984.1.33775 WP_002210984.1.33937 WP_002210984.1.34031 WP_002210984.1.34138 WP_002210984.1.35389 WP_002210984.1.35538 WP_002210984.1.36088 WP_002210984.1.37174 WP_002210984.1.37494 WP_002210984.1.37863 WP_002210984.1.38147 WP_002210984.1.38235 WP_002210984.1.38532 WP_002210984.1.38743 WP_002210984.1.38824 WP_002210984.1.38993 WP_002210984.1.39066 WP_002210984.1.39346 WP_002210984.1.3976 WP_002210984.1.39858 WP_002210984.1.40071 WP_002210984.1.40134 WP_002210984.1.40534 WP_002210984.1.40853 WP_002210984.1.41196 WP_002210984.1.41984 WP_002210984.1.42361 WP_002210984.1.42490 WP_002210984.1.42976 WP_002210984.1.44408 WP_002210984.1.44598 WP_002210984.1.45198 WP_002210984.1.45214 WP_002210984.1.46262 WP_002210984.1.46545 WP_002210984.1.46686 WP_002210984.1.46697 WP_002210984.1.46731 WP_002210984.1.4678 WP_002210984.1.46891 WP_002210984.1.47387 WP_002210984.1.47440 WP_002210984.1.47769 WP_002210984.1.47881 WP_002210984.1.48166 WP_002210984.1.48722 WP_002210984.1.4889 WP_002210984.1.49906 WP_002210984.1.4997 WP_002210984.1.50010 WP_002210984.1.50093 WP_002210984.1.50106 WP_002210984.1.50185 WP_002210984.1.50984 WP_002210984.1.51284 WP_002210984.1.51293 WP_002210984.1.51588 WP_002210984.1.51772 WP_002210984.1.51934 WP_002210984.1.52158 WP_002210984.1.52247 WP_002210984.1.52473 WP_002210984.1.52734 WP_002210984.1.52792 WP_002210984.1.52819 WP_002210984.1.52969 WP_002210984.1.53147 WP_002210984.1.53300 WP_002210984.1.53838 WP_002210984.1.53848 WP_002210984.1.53883 WP_002210984.1.53953 WP_002210984.1.54568 WP_002210984.1.54951 WP_002210984.1.55194 WP_002210984.1.55695 WP_002210984.1.5592 WP_002210984.1.56031 WP_002210984.1.56912 WP_002210984.1.56953 WP_002210984.1.57585 WP_002210984.1.57657 WP_002210984.1.58067 WP_002210984.1.58543 WP_002210984.1.58794 WP_002210984.1.59102 WP_002210984.1.59431 WP_002210984.1.5957 WP_002210984.1.59635 WP_002210984.1.5968 WP_002210984.1.59687 WP_002210984.1.59789 WP_002210984.1.59885 WP_002210984.1.60437 WP_002210984.1.60707 WP_002210984.1.60896 WP_002210984.1.61689 WP_002210984.1.62232 WP_002210984.1.62342 WP_002210984.1.6270 WP_002210984.1.6333 WP_002210984.1.63387 WP_002210984.1.63641 WP_002210984.1.64142 WP_002210984.1.64474 WP_002210984.1.64780 WP_002210984.1.64786 WP_002210984.1.64910 WP_002210984.1.653 WP_002210984.1.65400 WP_002210984.1.65554 WP_002210984.1.6570 WP_002210984.1.65706 WP_002210984.1.65718 WP_002210984.1.6581 WP_002210984.1.66118 WP_002210984.1.66546 WP_002210984.1.66616 WP_002210984.1.67404 WP_002210984.1.67850 WP_002210984.1.6791 WP_002210984.1.68361 WP_002210984.1.68371 WP_002210984.1.68855 WP_002210984.1.69018 WP_002210984.1.69316 WP_002210984.1.69951 WP_002210984.1.70117 WP_002210984.1.70171 WP_002210984.1.70319 WP_002210984.1.70377 WP_002210984.1.70417 WP_002210984.1.70726 WP_002210984.1.7083 WP_002210984.1.7169 WP_002210984.1.71744 WP_002210984.1.72280 WP_002210984.1.72440 WP_002210984.1.72486 WP_002210984.1.7402 WP_002210984.1.74131 WP_002210984.1.74310 WP_002210984.1.74577 WP_002210984.1.74738 WP_002210984.1.75169 WP_002210984.1.75173 WP_002210984.1.7518 WP_002210984.1.75208 WP_002210984.1.75337 WP_002210984.1.75407 WP_002210984.1.75636 WP_002210984.1.75689 WP_002210984.1.75821 WP_002210984.1.76555 WP_002210984.1.76670 WP_002210984.1.77295 WP_002210984.1.77387 WP_002210984.1.77429 WP_002210984.1.77569 WP_002210984.1.77691 WP_002210984.1.78004 WP_002210984.1.7841 WP_002210984.1.78556 WP_002210984.1.79515 WP_002210984.1.79550 WP_002210984.1.79825 WP_002210984.1.79981 WP_002210984.1.8009 WP_002210984.1.80331 WP_002210984.1.81848 WP_002210984.1.81877 WP_002210984.1.8210 WP_002210984.1.82133 WP_002210984.1.82151 WP_002210984.1.82270 WP_002210984.1.82436 WP_002210984.1.82619 WP_002210984.1.8303 WP_002210984.1.83039 WP_002210984.1.83265 WP_002210984.1.8420 WP_002210984.1.84703 WP_002210984.1.84720 WP_002210984.1.85269 WP_002210984.1.85270 WP_002210984.1.8559 WP_002210984.1.85802 WP_002210984.1.86034 WP_002210984.1.86059 WP_002210984.1.86413 WP_002210984.1.87107 WP_002210984.1.8728 WP_002210984.1.87418 WP_002210984.1.8762 WP_002210984.1.87853 WP_002210984.1.87988 WP_002210984.1.88362 WP_002210984.1.88472 WP_002210984.1.89359 WP_002210984.1.89542 WP_002210984.1.8964 WP_002210984.1.90176 WP_002210984.1.90624 WP_002210984.1.91263 WP_002210984.1.91373 WP_002210984.1.91844 WP_002210984.1.92030 WP_002210984.1.92331 WP_002210984.1.92604 WP_002210984.1.9311 WP_002210984.1.9320 WP_002210984.1.93623 WP_002210984.1.93928 WP_002210984.1.93933 WP_002210984.1.94052 WP_002210984.1.94201 WP_002210984.1.94545 WP_002210984.1.94683 WP_002210984.1.95746 WP_002210984.1.95981 WP_002210984.1.97245 WP_002210984.1.97375 WP_002210984.1.97448 WP_002210984.1.97791 WP_002210984.1.97864 WP_002210984.1.97872 WP_002210984.1.97894 WP_002210984.1.99109 WP_002210984.1.99383 WP_002210984.1.9941 WP_002210984.1.99416 WP_002210984.1.99788 WP_002210984.1.99882 WP_002210984.1.99972 WP_002210984.1.99990 YP_002347309.1.25044 gi|218929434|ref|YP_002347309.1| 187410.y1990 214092.YPO2342 229193.YP_2129 273123.YPTB2261 349747.YpsIP31758_1795 360102.YPA_1691 377628.YPN_1802 386656.YPDSF_0803 502800.YPK_1903 502801.YPTS_2338 gi|170024142|ref|YP_001720647.1| gi|108811964|ref|YP_647731.1| gi|186895644|ref|YP_001872756.1| gi|384125906|ref|YP_005508520.1| gi|384139831|ref|YP_005522533.1| gi|51596585|ref|YP_070776.1| gi|108807686|ref|YP_651602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]