SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294504366|ref|YP_003568428.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294504366|ref|YP_003568428.1|
Domain Number 1 Region: 36-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.58e-49
Family NQO2-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294504366|ref|YP_003568428.1|
Sequence length 187
Comment ATP synthase subunit E [Yersinia pestis Z176003]
Sequence
MSDQKETQAHNGSLDVVNLAVNAAEPAAMPDAFELSAEERDAIEHEKHHYEDARAASIEA
LKIVQKQRGWVPDGAIHAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHI
TGYQGIQAALEKKLSIKPGQTTFDGRFTLLPTCCLGNCDRGPTMMIDDDTHSYLKPEEIE
KLLEQYP
Download sequence
Identical sequences A0A0E1NQS4 A0A0H2YHZ5 A0A208S4Z4 Q8D0S9
gi|108812309|ref|YP_648076.1| gi|384126610|ref|YP_005509224.1| 187410.y1633 229193.YP_2363 360102.YPA_2044 377628.YPN_2147 386656.YPDSF_1962 gi|294504366|ref|YP_003568428.1| gi|384139618|ref|YP_005522320.1| gi|22125528|ref|NP_668951.1| gi|108808039|ref|YP_651955.1| WP_002228514.1.100083 WP_002228514.1.100246 WP_002228514.1.102012 WP_002228514.1.10736 WP_002228514.1.10935 WP_002228514.1.12857 WP_002228514.1.1388 WP_002228514.1.14063 WP_002228514.1.15605 WP_002228514.1.16243 WP_002228514.1.16333 WP_002228514.1.17135 WP_002228514.1.17608 WP_002228514.1.18826 WP_002228514.1.19329 WP_002228514.1.19425 WP_002228514.1.21784 WP_002228514.1.21879 WP_002228514.1.23157 WP_002228514.1.23687 WP_002228514.1.25181 WP_002228514.1.29355 WP_002228514.1.29622 WP_002228514.1.29685 WP_002228514.1.30931 WP_002228514.1.311 WP_002228514.1.31496 WP_002228514.1.31739 WP_002228514.1.32446 WP_002228514.1.33937 WP_002228514.1.37494 WP_002228514.1.38993 WP_002228514.1.39066 WP_002228514.1.3976 WP_002228514.1.40853 WP_002228514.1.4210 WP_002228514.1.44408 WP_002228514.1.46686 WP_002228514.1.46731 WP_002228514.1.4678 WP_002228514.1.47387 WP_002228514.1.47440 WP_002228514.1.48166 WP_002228514.1.48722 WP_002228514.1.51934 WP_002228514.1.52158 WP_002228514.1.54951 WP_002228514.1.56031 WP_002228514.1.56912 WP_002228514.1.59102 WP_002228514.1.59431 WP_002228514.1.59789 WP_002228514.1.59885 WP_002228514.1.60437 WP_002228514.1.60707 WP_002228514.1.60896 WP_002228514.1.6270 WP_002228514.1.65400 WP_002228514.1.65718 WP_002228514.1.66118 WP_002228514.1.68753 WP_002228514.1.69316 WP_002228514.1.70319 WP_002228514.1.72280 WP_002228514.1.72486 WP_002228514.1.7402 WP_002228514.1.7518 WP_002228514.1.75337 WP_002228514.1.75636 WP_002228514.1.77387 WP_002228514.1.78004 WP_002228514.1.8009 WP_002228514.1.82133 WP_002228514.1.82619 WP_002228514.1.83039 WP_002228514.1.84703 WP_002228514.1.85802 WP_002228514.1.86034 WP_002228514.1.8762 WP_002228514.1.87988 WP_002228514.1.88472 WP_002228514.1.8964 WP_002228514.1.90624 WP_002228514.1.91373 WP_002228514.1.92030 WP_002228514.1.92331 WP_002228514.1.92604 WP_002228514.1.9311 WP_002228514.1.94052 WP_002228514.1.99109 gi|145599242|ref|YP_001163318.1| gi|45442152|ref|NP_993691.1| gi|384123049|ref|YP_005505669.1| gi|384414106|ref|YP_005623468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]