SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294504672|ref|YP_003568734.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294504672|ref|YP_003568734.1|
Domain Number 1 Region: 51-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-39
Family Glutathione peroxidase-like 0.00000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294504672|ref|YP_003568734.1|
Sequence length 188
Comment thiol:disulfide interchange protein DsbE [Yersinia pestis Z176003]
Sequence
MKPQSSFNKLMFIPLVLFLLLVVAFLIQLTRNANGEDPTMLESALIGKPVPAFKLESLEQ
PGKTFDQAVLRDGKPILLNVWATWCPTCRAEHEYLNKLAAQGIRVVGLNYKDDRSKAVQW
LNSLGNPYFLSLYDGDGMLGLDLGVYGAPETFLIDGQGVIRYRHAGDLNDRVWQQEILPL
YKKYQGGA
Download sequence
Identical sequences A0A0E8XH84 A0A0H2Y962 A0A0H3B1W3 A0A0M1VAA1 A0A0U1ESR8 A0A0U1QV94 A0A154S3H7 A0A208S751 A0A2A7VHF3 Q668U4 Q8ZD52
gi|170023743|ref|YP_001720248.1| gi|218929812|ref|YP_002347687.1| gi|108808098|ref|YP_652014.1| gi|51596962|ref|YP_071153.1| gi|384139419|ref|YP_005522121.1| gi|186896045|ref|YP_001873157.1| gi|294504672|ref|YP_003568734.1| gi|153947450|ref|YP_001400372.1| gi|145599298|ref|YP_001163374.1| gi|22125468|ref|NP_668891.1| gi|384123138|ref|YP_005505758.1| WP_002209699.1.100083 WP_002209699.1.100246 WP_002209699.1.100593 WP_002209699.1.10066 WP_002209699.1.100921 WP_002209699.1.100931 WP_002209699.1.10105 WP_002209699.1.101305 WP_002209699.1.101382 WP_002209699.1.101928 WP_002209699.1.102012 WP_002209699.1.102067 WP_002209699.1.10736 WP_002209699.1.10935 WP_002209699.1.10955 WP_002209699.1.11693 WP_002209699.1.12167 WP_002209699.1.12463 WP_002209699.1.12736 WP_002209699.1.12857 WP_002209699.1.1388 WP_002209699.1.14063 WP_002209699.1.14169 WP_002209699.1.14804 WP_002209699.1.15321 WP_002209699.1.15605 WP_002209699.1.15689 WP_002209699.1.16243 WP_002209699.1.17135 WP_002209699.1.17141 WP_002209699.1.17608 WP_002209699.1.17873 WP_002209699.1.17983 WP_002209699.1.18208 WP_002209699.1.18640 WP_002209699.1.18826 WP_002209699.1.19329 WP_002209699.1.19425 WP_002209699.1.19739 WP_002209699.1.20035 WP_002209699.1.20380 WP_002209699.1.20547 WP_002209699.1.2064 WP_002209699.1.20932 WP_002209699.1.21486 WP_002209699.1.21784 WP_002209699.1.21879 WP_002209699.1.21934 WP_002209699.1.22530 WP_002209699.1.22542 WP_002209699.1.22708 WP_002209699.1.23271 WP_002209699.1.23687 WP_002209699.1.23811 WP_002209699.1.2451 WP_002209699.1.24517 WP_002209699.1.25181 WP_002209699.1.25394 WP_002209699.1.26383 WP_002209699.1.2640 WP_002209699.1.26509 WP_002209699.1.26776 WP_002209699.1.26960 WP_002209699.1.27124 WP_002209699.1.27251 WP_002209699.1.2726 WP_002209699.1.28647 WP_002209699.1.28922 WP_002209699.1.29157 WP_002209699.1.29186 WP_002209699.1.29355 WP_002209699.1.2947 WP_002209699.1.29622 WP_002209699.1.2964 WP_002209699.1.29685 WP_002209699.1.29814 WP_002209699.1.3092 WP_002209699.1.30931 WP_002209699.1.311 WP_002209699.1.31336 WP_002209699.1.31496 WP_002209699.1.31721 WP_002209699.1.31739 WP_002209699.1.31805 WP_002209699.1.32343 WP_002209699.1.32388 WP_002209699.1.32446 WP_002209699.1.32736 WP_002209699.1.33203 WP_002209699.1.33324 WP_002209699.1.33661 WP_002209699.1.33775 WP_002209699.1.33937 WP_002209699.1.34031 WP_002209699.1.34138 WP_002209699.1.35389 WP_002209699.1.35538 WP_002209699.1.36088 WP_002209699.1.37174 WP_002209699.1.37494 WP_002209699.1.37863 WP_002209699.1.38147 WP_002209699.1.38235 WP_002209699.1.38532 WP_002209699.1.38743 WP_002209699.1.38824 WP_002209699.1.38993 WP_002209699.1.39066 WP_002209699.1.39346 WP_002209699.1.3976 WP_002209699.1.39858 WP_002209699.1.40071 WP_002209699.1.40134 WP_002209699.1.40534 WP_002209699.1.40853 WP_002209699.1.41196 WP_002209699.1.41984 WP_002209699.1.4210 WP_002209699.1.42361 WP_002209699.1.42490 WP_002209699.1.42976 WP_002209699.1.44408 WP_002209699.1.44598 WP_002209699.1.44603 WP_002209699.1.44832 WP_002209699.1.45198 WP_002209699.1.45214 WP_002209699.1.46262 WP_002209699.1.46545 WP_002209699.1.46686 WP_002209699.1.46697 WP_002209699.1.46731 WP_002209699.1.4678 WP_002209699.1.46891 WP_002209699.1.47387 WP_002209699.1.47881 WP_002209699.1.48166 WP_002209699.1.48722 WP_002209699.1.4889 WP_002209699.1.49315 WP_002209699.1.49906 WP_002209699.1.4997 WP_002209699.1.50010 WP_002209699.1.50093 WP_002209699.1.50106 WP_002209699.1.50185 WP_002209699.1.51284 WP_002209699.1.51293 WP_002209699.1.51588 WP_002209699.1.51772 WP_002209699.1.51934 WP_002209699.1.52158 WP_002209699.1.52247 WP_002209699.1.52473 WP_002209699.1.52569 WP_002209699.1.52734 WP_002209699.1.52792 WP_002209699.1.52819 WP_002209699.1.52969 WP_002209699.1.53147 WP_002209699.1.53300 WP_002209699.1.53838 WP_002209699.1.53848 WP_002209699.1.53883 WP_002209699.1.53953 WP_002209699.1.54568 WP_002209699.1.54951 WP_002209699.1.55194 WP_002209699.1.55695 WP_002209699.1.5592 WP_002209699.1.56031 WP_002209699.1.56912 WP_002209699.1.56953 WP_002209699.1.57585 WP_002209699.1.57657 WP_002209699.1.58067 WP_002209699.1.58543 WP_002209699.1.58794 WP_002209699.1.59102 WP_002209699.1.59431 WP_002209699.1.5957 WP_002209699.1.59635 WP_002209699.1.5968 WP_002209699.1.59687 WP_002209699.1.60437 WP_002209699.1.60707 WP_002209699.1.60896 WP_002209699.1.61689 WP_002209699.1.62232 WP_002209699.1.62342 WP_002209699.1.6270 WP_002209699.1.6333 WP_002209699.1.63387 WP_002209699.1.63517 WP_002209699.1.63641 WP_002209699.1.64142 WP_002209699.1.64474 WP_002209699.1.64780 WP_002209699.1.64786 WP_002209699.1.64910 WP_002209699.1.653 WP_002209699.1.65400 WP_002209699.1.65554 WP_002209699.1.6570 WP_002209699.1.65706 WP_002209699.1.65718 WP_002209699.1.6581 WP_002209699.1.66546 WP_002209699.1.66616 WP_002209699.1.67404 WP_002209699.1.6791 WP_002209699.1.68361 WP_002209699.1.68371 WP_002209699.1.68753 WP_002209699.1.68855 WP_002209699.1.69018 WP_002209699.1.69316 WP_002209699.1.69951 WP_002209699.1.70117 WP_002209699.1.70171 WP_002209699.1.70319 WP_002209699.1.70377 WP_002209699.1.70417 WP_002209699.1.70726 WP_002209699.1.7083 WP_002209699.1.7169 WP_002209699.1.71744 WP_002209699.1.72280 WP_002209699.1.72440 WP_002209699.1.72486 WP_002209699.1.7402 WP_002209699.1.74577 WP_002209699.1.74738 WP_002209699.1.75169 WP_002209699.1.7518 WP_002209699.1.75208 WP_002209699.1.75337 WP_002209699.1.75407 WP_002209699.1.75636 WP_002209699.1.75689 WP_002209699.1.75821 WP_002209699.1.76555 WP_002209699.1.77295 WP_002209699.1.77387 WP_002209699.1.77429 WP_002209699.1.77569 WP_002209699.1.77691 WP_002209699.1.78004 WP_002209699.1.78556 WP_002209699.1.79515 WP_002209699.1.79550 WP_002209699.1.79609 WP_002209699.1.79825 WP_002209699.1.79981 WP_002209699.1.8009 WP_002209699.1.80331 WP_002209699.1.81848 WP_002209699.1.81877 WP_002209699.1.8210 WP_002209699.1.82133 WP_002209699.1.82151 WP_002209699.1.82270 WP_002209699.1.82436 WP_002209699.1.82619 WP_002209699.1.8303 WP_002209699.1.83039 WP_002209699.1.83102 WP_002209699.1.83265 WP_002209699.1.83630 WP_002209699.1.8420 WP_002209699.1.84720 WP_002209699.1.85269 WP_002209699.1.85270 WP_002209699.1.8559 WP_002209699.1.85802 WP_002209699.1.86034 WP_002209699.1.86059 WP_002209699.1.86413 WP_002209699.1.8728 WP_002209699.1.87418 WP_002209699.1.8762 WP_002209699.1.87853 WP_002209699.1.87988 WP_002209699.1.88362 WP_002209699.1.88472 WP_002209699.1.89359 WP_002209699.1.89542 WP_002209699.1.8964 WP_002209699.1.90176 WP_002209699.1.9051 WP_002209699.1.90624 WP_002209699.1.91263 WP_002209699.1.91844 WP_002209699.1.92030 WP_002209699.1.92331 WP_002209699.1.92604 WP_002209699.1.927 WP_002209699.1.9311 WP_002209699.1.9320 WP_002209699.1.93623 WP_002209699.1.93928 WP_002209699.1.93933 WP_002209699.1.94201 WP_002209699.1.94545 WP_002209699.1.94683 WP_002209699.1.95746 WP_002209699.1.95981 WP_002209699.1.97245 WP_002209699.1.97375 WP_002209699.1.97448 WP_002209699.1.97791 WP_002209699.1.97864 WP_002209699.1.97872 WP_002209699.1.97894 WP_002209699.1.99109 WP_002209699.1.99383 WP_002209699.1.9941 WP_002209699.1.99416 WP_002209699.1.99788 WP_002209699.1.99882 WP_002209699.1.99972 WP_002209699.1.99990 YP_002347687.1.25044 gi|162419925|ref|YP_001604996.1| 187410.y1573 214092.YPO2740 273123.YPTB2643 349746.YpAngola_A0389 349747.YpsIP31758_1393 360102.YPA_2104 386656.YPDSF_2020 502800.YPK_1502 502801.YPTS_2740 gi|384126995|ref|YP_005509609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]