SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294504810|ref|YP_003568872.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294504810|ref|YP_003568872.1|
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.29e-50
Family Glutathione peroxidase-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294504810|ref|YP_003568872.1|
Sequence length 156
Comment bacterioferritin comigratory protein [Yersinia pestis Z176003]
Sequence
MSPLKAGDIAPKFSLPDQDGEQISLADFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDEL
KSAGVEVLGISTDKPEKLSRFAEKELLNFTLLSDEHHEVAEQFGVWGEKSFMGKTYNGIH
RISFLIDADGKVEHVFDNFKTNNHHDIVMDYLRQNA
Download sequence
Identical sequences A0A0E1NXR0 A0A0H2YFY6 A0A0U1QY19 A0A154S883 A0A208RMW7 A0A2A7VHG0
gi|153948624|ref|YP_001400225.1| gi|384123277|ref|YP_005505897.1| gi|108808249|ref|YP_652165.1| 349746.YpAngola_A3130 349747.YpsIP31758_1245 360102.YPA_2255 377628.YPN_1321 386656.YPDSF_2169 gi|145599443|ref|YP_001163519.1| WP_002224836.1.100083 WP_002224836.1.100921 WP_002224836.1.101382 WP_002224836.1.102012 WP_002224836.1.102067 WP_002224836.1.10736 WP_002224836.1.10935 WP_002224836.1.10955 WP_002224836.1.11693 WP_002224836.1.12167 WP_002224836.1.12736 WP_002224836.1.12857 WP_002224836.1.1388 WP_002224836.1.14169 WP_002224836.1.14804 WP_002224836.1.15321 WP_002224836.1.15555 WP_002224836.1.15689 WP_002224836.1.16243 WP_002224836.1.16333 WP_002224836.1.17141 WP_002224836.1.17608 WP_002224836.1.18208 WP_002224836.1.18826 WP_002224836.1.19329 WP_002224836.1.19425 WP_002224836.1.19763 WP_002224836.1.20547 WP_002224836.1.2064 WP_002224836.1.21784 WP_002224836.1.21879 WP_002224836.1.21934 WP_002224836.1.22530 WP_002224836.1.22542 WP_002224836.1.23157 WP_002224836.1.23687 WP_002224836.1.23811 WP_002224836.1.24002 WP_002224836.1.2451 WP_002224836.1.25181 WP_002224836.1.25394 WP_002224836.1.26776 WP_002224836.1.27124 WP_002224836.1.28647 WP_002224836.1.28922 WP_002224836.1.29157 WP_002224836.1.29355 WP_002224836.1.2947 WP_002224836.1.29622 WP_002224836.1.2964 WP_002224836.1.29685 WP_002224836.1.29814 WP_002224836.1.3092 WP_002224836.1.30931 WP_002224836.1.311 WP_002224836.1.31336 WP_002224836.1.31739 WP_002224836.1.31805 WP_002224836.1.32388 WP_002224836.1.33203 WP_002224836.1.33661 WP_002224836.1.34031 WP_002224836.1.34138 WP_002224836.1.36088 WP_002224836.1.37174 WP_002224836.1.37494 WP_002224836.1.38147 WP_002224836.1.38235 WP_002224836.1.38532 WP_002224836.1.38743 WP_002224836.1.38824 WP_002224836.1.38993 WP_002224836.1.39346 WP_002224836.1.3976 WP_002224836.1.40071 WP_002224836.1.40534 WP_002224836.1.40853 WP_002224836.1.41196 WP_002224836.1.41984 WP_002224836.1.4210 WP_002224836.1.42976 WP_002224836.1.44408 WP_002224836.1.44598 WP_002224836.1.44603 WP_002224836.1.44832 WP_002224836.1.45198 WP_002224836.1.46262 WP_002224836.1.46731 WP_002224836.1.4678 WP_002224836.1.46891 WP_002224836.1.47440 WP_002224836.1.47769 WP_002224836.1.48166 WP_002224836.1.4889 WP_002224836.1.49315 WP_002224836.1.49906 WP_002224836.1.50984 WP_002224836.1.51284 WP_002224836.1.51772 WP_002224836.1.52247 WP_002224836.1.52473 WP_002224836.1.52969 WP_002224836.1.53300 WP_002224836.1.53848 WP_002224836.1.54568 WP_002224836.1.55695 WP_002224836.1.5592 WP_002224836.1.56031 WP_002224836.1.56912 WP_002224836.1.56953 WP_002224836.1.57585 WP_002224836.1.57657 WP_002224836.1.58543 WP_002224836.1.58794 WP_002224836.1.59687 WP_002224836.1.59789 WP_002224836.1.59885 WP_002224836.1.60437 WP_002224836.1.60707 WP_002224836.1.60896 WP_002224836.1.6270 WP_002224836.1.6333 WP_002224836.1.63387 WP_002224836.1.64474 WP_002224836.1.64780 WP_002224836.1.653 WP_002224836.1.65554 WP_002224836.1.6570 WP_002224836.1.6581 WP_002224836.1.66546 WP_002224836.1.67404 WP_002224836.1.67850 WP_002224836.1.68371 WP_002224836.1.68753 WP_002224836.1.68855 WP_002224836.1.69316 WP_002224836.1.69951 WP_002224836.1.70117 WP_002224836.1.70726 WP_002224836.1.7083 WP_002224836.1.72280 WP_002224836.1.72440 WP_002224836.1.72486 WP_002224836.1.7402 WP_002224836.1.74131 WP_002224836.1.74310 WP_002224836.1.74577 WP_002224836.1.74738 WP_002224836.1.7518 WP_002224836.1.75337 WP_002224836.1.75407 WP_002224836.1.75636 WP_002224836.1.75689 WP_002224836.1.75821 WP_002224836.1.76670 WP_002224836.1.77691 WP_002224836.1.78004 WP_002224836.1.79515 WP_002224836.1.79550 WP_002224836.1.79609 WP_002224836.1.8009 WP_002224836.1.8210 WP_002224836.1.82133 WP_002224836.1.82270 WP_002224836.1.82436 WP_002224836.1.83039 WP_002224836.1.83265 WP_002224836.1.83630 WP_002224836.1.84703 WP_002224836.1.85269 WP_002224836.1.85270 WP_002224836.1.85802 WP_002224836.1.86413 WP_002224836.1.87107 WP_002224836.1.8728 WP_002224836.1.8762 WP_002224836.1.87853 WP_002224836.1.88362 WP_002224836.1.88472 WP_002224836.1.89359 WP_002224836.1.89542 WP_002224836.1.90176 WP_002224836.1.9051 WP_002224836.1.90624 WP_002224836.1.91263 WP_002224836.1.91373 WP_002224836.1.91844 WP_002224836.1.92030 WP_002224836.1.92604 WP_002224836.1.927 WP_002224836.1.93623 WP_002224836.1.93928 WP_002224836.1.94052 WP_002224836.1.94545 WP_002224836.1.95746 WP_002224836.1.95981 WP_002224836.1.97245 WP_002224836.1.97864 WP_002224836.1.97872 WP_002224836.1.99383 WP_002224836.1.9941 WP_002224836.1.99416 WP_002224836.1.99788 gi|162418156|ref|YP_001607492.1| gi|384127132|ref|YP_005509746.1| gi|108811484|ref|YP_647251.1| gi|384413870|ref|YP_005623232.1| gi|294504810|ref|YP_003568872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]