SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294504814|ref|YP_003568876.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294504814|ref|YP_003568876.1|
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.8e-36
Family ArsC-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294504814|ref|YP_003568876.1|
Sequence length 118
Comment putative arsenate reductase [Yersinia pestis Z176003]
Sequence
MKDVTIYHNPRCSKSRETLALVEQQGITPQVVLYLETPPSVDKLKELLQQLGFSDARQLM
RTKEDLYKTLNLDDRGLTQDQLLQAMADNPKLIERPIVVTQGKARIGRPPEQVLEILK
Download sequence
Identical sequences A0A0E1NQ60 A0A0H2YFZ7 A0A0H3AZS4 A0A0M1VDC6 A0A0T9PFY2 A0A0T9Q5K1 A0A0U1ETG9 A0A0U1R0T5 A0A208RMY4 Q0WCJ8 Q668E9
gi|170023597|ref|YP_001720102.1| gi|186896198|ref|YP_001873310.1| gi|108808255|ref|YP_652171.1| 214092.YPO3070 273123.YPTB2791 349746.YpAngola_A3126 349747.YpsIP31758_1238 360102.YPA_2261 377628.YPN_1314 386656.YPDSF_2174 502800.YPK_1355 502801.YPTS_2896 gi|153949799|ref|YP_001400219.1| gi|384123281|ref|YP_005505901.1| gi|384139084|ref|YP_005521786.1| gi|384127136|ref|YP_005509750.1| IDP00581 gi|384413863|ref|YP_005623225.1| gi|294504814|ref|YP_003568876.1| gi|145599448|ref|YP_001163524.1| gi|218930115|ref|YP_002347990.1| gi|51597107|ref|YP_071298.1| WP_002208565.1.100083 WP_002208565.1.100246 WP_002208565.1.100593 WP_002208565.1.10066 WP_002208565.1.100921 WP_002208565.1.100931 WP_002208565.1.10105 WP_002208565.1.101305 WP_002208565.1.101382 WP_002208565.1.101928 WP_002208565.1.102012 WP_002208565.1.102067 WP_002208565.1.10736 WP_002208565.1.10935 WP_002208565.1.10955 WP_002208565.1.11693 WP_002208565.1.12167 WP_002208565.1.12463 WP_002208565.1.12736 WP_002208565.1.12857 WP_002208565.1.1388 WP_002208565.1.14063 WP_002208565.1.14169 WP_002208565.1.14804 WP_002208565.1.15321 WP_002208565.1.15555 WP_002208565.1.15605 WP_002208565.1.15689 WP_002208565.1.16243 WP_002208565.1.16333 WP_002208565.1.17135 WP_002208565.1.17141 WP_002208565.1.17608 WP_002208565.1.17873 WP_002208565.1.17983 WP_002208565.1.18208 WP_002208565.1.18640 WP_002208565.1.18826 WP_002208565.1.19329 WP_002208565.1.19425 WP_002208565.1.19739 WP_002208565.1.19763 WP_002208565.1.20035 WP_002208565.1.20380 WP_002208565.1.20547 WP_002208565.1.2064 WP_002208565.1.20932 WP_002208565.1.21486 WP_002208565.1.21784 WP_002208565.1.21879 WP_002208565.1.21934 WP_002208565.1.22530 WP_002208565.1.22542 WP_002208565.1.22708 WP_002208565.1.23157 WP_002208565.1.23271 WP_002208565.1.23687 WP_002208565.1.23811 WP_002208565.1.24002 WP_002208565.1.2451 WP_002208565.1.24517 WP_002208565.1.25181 WP_002208565.1.25394 WP_002208565.1.26383 WP_002208565.1.2640 WP_002208565.1.26776 WP_002208565.1.26960 WP_002208565.1.27124 WP_002208565.1.27251 WP_002208565.1.2726 WP_002208565.1.28647 WP_002208565.1.28922 WP_002208565.1.29157 WP_002208565.1.29186 WP_002208565.1.29355 WP_002208565.1.2947 WP_002208565.1.29622 WP_002208565.1.2964 WP_002208565.1.29685 WP_002208565.1.29814 WP_002208565.1.3092 WP_002208565.1.30931 WP_002208565.1.311 WP_002208565.1.31336 WP_002208565.1.31496 WP_002208565.1.31721 WP_002208565.1.31739 WP_002208565.1.31805 WP_002208565.1.32343 WP_002208565.1.32388 WP_002208565.1.32446 WP_002208565.1.32736 WP_002208565.1.33203 WP_002208565.1.33324 WP_002208565.1.33661 WP_002208565.1.33775 WP_002208565.1.33937 WP_002208565.1.34031 WP_002208565.1.34138 WP_002208565.1.35389 WP_002208565.1.35538 WP_002208565.1.36088 WP_002208565.1.37174 WP_002208565.1.37494 WP_002208565.1.37863 WP_002208565.1.38147 WP_002208565.1.38235 WP_002208565.1.38532 WP_002208565.1.38743 WP_002208565.1.38824 WP_002208565.1.38993 WP_002208565.1.39066 WP_002208565.1.39346 WP_002208565.1.3976 WP_002208565.1.39858 WP_002208565.1.40071 WP_002208565.1.40134 WP_002208565.1.40534 WP_002208565.1.40853 WP_002208565.1.41196 WP_002208565.1.41984 WP_002208565.1.4210 WP_002208565.1.42361 WP_002208565.1.42490 WP_002208565.1.42976 WP_002208565.1.44408 WP_002208565.1.44598 WP_002208565.1.44603 WP_002208565.1.44832 WP_002208565.1.45198 WP_002208565.1.45214 WP_002208565.1.46262 WP_002208565.1.46545 WP_002208565.1.46686 WP_002208565.1.46697 WP_002208565.1.46731 WP_002208565.1.4678 WP_002208565.1.46891 WP_002208565.1.47387 WP_002208565.1.47440 WP_002208565.1.47769 WP_002208565.1.47881 WP_002208565.1.48166 WP_002208565.1.48722 WP_002208565.1.4889 WP_002208565.1.49315 WP_002208565.1.49906 WP_002208565.1.4997 WP_002208565.1.50010 WP_002208565.1.50093 WP_002208565.1.50106 WP_002208565.1.50185 WP_002208565.1.50984 WP_002208565.1.51284 WP_002208565.1.51293 WP_002208565.1.51588 WP_002208565.1.51772 WP_002208565.1.51934 WP_002208565.1.52158 WP_002208565.1.52167 WP_002208565.1.52247 WP_002208565.1.52473 WP_002208565.1.52734 WP_002208565.1.52792 WP_002208565.1.52819 WP_002208565.1.52969 WP_002208565.1.53147 WP_002208565.1.53300 WP_002208565.1.53838 WP_002208565.1.53848 WP_002208565.1.53883 WP_002208565.1.53953 WP_002208565.1.54568 WP_002208565.1.54951 WP_002208565.1.55194 WP_002208565.1.55695 WP_002208565.1.5592 WP_002208565.1.56031 WP_002208565.1.56912 WP_002208565.1.56953 WP_002208565.1.57585 WP_002208565.1.57657 WP_002208565.1.58067 WP_002208565.1.58543 WP_002208565.1.58794 WP_002208565.1.59102 WP_002208565.1.59324 WP_002208565.1.59431 WP_002208565.1.5957 WP_002208565.1.59635 WP_002208565.1.5968 WP_002208565.1.59687 WP_002208565.1.59789 WP_002208565.1.59885 WP_002208565.1.60437 WP_002208565.1.60707 WP_002208565.1.60896 WP_002208565.1.61689 WP_002208565.1.62232 WP_002208565.1.62342 WP_002208565.1.6270 WP_002208565.1.6333 WP_002208565.1.63387 WP_002208565.1.63641 WP_002208565.1.64142 WP_002208565.1.64474 WP_002208565.1.64780 WP_002208565.1.64786 WP_002208565.1.64910 WP_002208565.1.653 WP_002208565.1.65400 WP_002208565.1.65554 WP_002208565.1.6570 WP_002208565.1.65706 WP_002208565.1.65718 WP_002208565.1.6581 WP_002208565.1.66118 WP_002208565.1.66546 WP_002208565.1.66616 WP_002208565.1.67404 WP_002208565.1.67850 WP_002208565.1.6791 WP_002208565.1.68361 WP_002208565.1.68371 WP_002208565.1.68753 WP_002208565.1.68855 WP_002208565.1.69018 WP_002208565.1.69316 WP_002208565.1.69951 WP_002208565.1.70117 WP_002208565.1.70171 WP_002208565.1.70319 WP_002208565.1.70377 WP_002208565.1.70417 WP_002208565.1.70726 WP_002208565.1.7083 WP_002208565.1.7169 WP_002208565.1.71744 WP_002208565.1.72280 WP_002208565.1.72440 WP_002208565.1.72486 WP_002208565.1.7402 WP_002208565.1.74131 WP_002208565.1.74310 WP_002208565.1.74577 WP_002208565.1.74738 WP_002208565.1.75169 WP_002208565.1.75173 WP_002208565.1.7518 WP_002208565.1.75208 WP_002208565.1.75337 WP_002208565.1.75407 WP_002208565.1.75636 WP_002208565.1.75689 WP_002208565.1.75821 WP_002208565.1.76555 WP_002208565.1.76670 WP_002208565.1.77295 WP_002208565.1.77387 WP_002208565.1.77429 WP_002208565.1.77569 WP_002208565.1.77691 WP_002208565.1.78004 WP_002208565.1.7841 WP_002208565.1.78556 WP_002208565.1.79515 WP_002208565.1.79550 WP_002208565.1.79609 WP_002208565.1.79825 WP_002208565.1.79981 WP_002208565.1.8009 WP_002208565.1.80331 WP_002208565.1.81848 WP_002208565.1.81877 WP_002208565.1.8210 WP_002208565.1.82133 WP_002208565.1.82151 WP_002208565.1.82270 WP_002208565.1.82436 WP_002208565.1.82619 WP_002208565.1.8303 WP_002208565.1.83039 WP_002208565.1.83265 WP_002208565.1.83630 WP_002208565.1.8420 WP_002208565.1.84703 WP_002208565.1.84720 WP_002208565.1.85269 WP_002208565.1.85270 WP_002208565.1.8559 WP_002208565.1.85802 WP_002208565.1.86034 WP_002208565.1.86059 WP_002208565.1.86413 WP_002208565.1.87107 WP_002208565.1.8728 WP_002208565.1.87418 WP_002208565.1.8762 WP_002208565.1.87853 WP_002208565.1.87988 WP_002208565.1.88362 WP_002208565.1.88472 WP_002208565.1.89359 WP_002208565.1.89542 WP_002208565.1.8964 WP_002208565.1.90176 WP_002208565.1.9051 WP_002208565.1.90624 WP_002208565.1.91263 WP_002208565.1.91373 WP_002208565.1.91844 WP_002208565.1.92030 WP_002208565.1.92331 WP_002208565.1.92604 WP_002208565.1.927 WP_002208565.1.9311 WP_002208565.1.9320 WP_002208565.1.93623 WP_002208565.1.93928 WP_002208565.1.93933 WP_002208565.1.94052 WP_002208565.1.94201 WP_002208565.1.94545 WP_002208565.1.94683 WP_002208565.1.95746 WP_002208565.1.95981 WP_002208565.1.97245 WP_002208565.1.97375 WP_002208565.1.97448 WP_002208565.1.97791 WP_002208565.1.97864 WP_002208565.1.97872 WP_002208565.1.97894 WP_002208565.1.99109 WP_002208565.1.99383 WP_002208565.1.9941 WP_002208565.1.99416 WP_002208565.1.99788 WP_002208565.1.99882 WP_002208565.1.99972 WP_002208565.1.99990 YP_002347990.1.25044 gi|108811477|ref|YP_647244.1| gi|162421853|ref|YP_001607488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]