SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294505566|ref|YP_003569628.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294505566|ref|YP_003569628.1|
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.3e-46
Family Glutathione peroxidase-like 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294505566|ref|YP_003569628.1|
Sequence length 243
Comment putative peroxiredoxin/glutaredoxin family protein [Yersinia pestis Z176003]
Sequence
MFTSQEGKKVPQVTFHTRQGDQWIDVTTDDLFSNKTVIVFSLPGAFTPTCSSSHLPRYNE
LAGVFKQHGVDSILCVSVNDTFVMNAWKSDQHAENITFVPDGNGEFTKGMNMLVEKADLG
FGPRSWRYSMLVRNGVVEKMFVEPNKPGDPFEVSDADTMLKYLAPDFKVQESVAVFTKPG
CPFCAKAKQMLQDHGLQYEEIVLGKDATTVSLRAVSGRSTVPQIFIGGRHIGGSDDLEKY
LPA
Download sequence
Identical sequences A0A0E1NX26 A0A0H2YD70 A0A0H3B7P6 A0A0M1VBI8 A0A0T9MPW0 A0A0T9R9D5 A0A0U1EXZ5 A0A0U1QZS4 A0A208RWL9 Q0WA97 Q66G63 Q7CL11
187410.y0319 214092.YPO3916 229193.YP_3132 273123.YPTB0119 349746.YpAngola_A0117 349747.YpsIP31758_0136 360102.YPA_0106 377628.YPN_0051 386656.YPDSF_3528 502800.YPK_4080 502801.YPTS_0125 gi|162419256|ref|YP_001604753.1| WP_002209479.1.100083 WP_002209479.1.100246 WP_002209479.1.10066 WP_002209479.1.100921 WP_002209479.1.100931 WP_002209479.1.10105 WP_002209479.1.101305 WP_002209479.1.101382 WP_002209479.1.101928 WP_002209479.1.102012 WP_002209479.1.102067 WP_002209479.1.10736 WP_002209479.1.10935 WP_002209479.1.10955 WP_002209479.1.11693 WP_002209479.1.12167 WP_002209479.1.12463 WP_002209479.1.12736 WP_002209479.1.12857 WP_002209479.1.1388 WP_002209479.1.14063 WP_002209479.1.14169 WP_002209479.1.14804 WP_002209479.1.15321 WP_002209479.1.15555 WP_002209479.1.15605 WP_002209479.1.15689 WP_002209479.1.16243 WP_002209479.1.16333 WP_002209479.1.17135 WP_002209479.1.17141 WP_002209479.1.17608 WP_002209479.1.17873 WP_002209479.1.17983 WP_002209479.1.18208 WP_002209479.1.18640 WP_002209479.1.19329 WP_002209479.1.19425 WP_002209479.1.19739 WP_002209479.1.19763 WP_002209479.1.20035 WP_002209479.1.20380 WP_002209479.1.20547 WP_002209479.1.2064 WP_002209479.1.20932 WP_002209479.1.21486 WP_002209479.1.21784 WP_002209479.1.21879 WP_002209479.1.21934 WP_002209479.1.22530 WP_002209479.1.22542 WP_002209479.1.22708 WP_002209479.1.23157 WP_002209479.1.23271 WP_002209479.1.23687 WP_002209479.1.23811 WP_002209479.1.24002 WP_002209479.1.2451 WP_002209479.1.24517 WP_002209479.1.25181 WP_002209479.1.25394 WP_002209479.1.26383 WP_002209479.1.2640 WP_002209479.1.26776 WP_002209479.1.26960 WP_002209479.1.27124 WP_002209479.1.27251 WP_002209479.1.2726 WP_002209479.1.28922 WP_002209479.1.29157 WP_002209479.1.29355 WP_002209479.1.2947 WP_002209479.1.29622 WP_002209479.1.2964 WP_002209479.1.29685 WP_002209479.1.29814 WP_002209479.1.3092 WP_002209479.1.30931 WP_002209479.1.311 WP_002209479.1.31496 WP_002209479.1.31739 WP_002209479.1.31805 WP_002209479.1.32343 WP_002209479.1.32388 WP_002209479.1.32446 WP_002209479.1.32736 WP_002209479.1.33203 WP_002209479.1.33324 WP_002209479.1.33661 WP_002209479.1.33937 WP_002209479.1.34031 WP_002209479.1.34138 WP_002209479.1.35389 WP_002209479.1.35538 WP_002209479.1.36088 WP_002209479.1.37174 WP_002209479.1.37494 WP_002209479.1.37863 WP_002209479.1.38147 WP_002209479.1.38235 WP_002209479.1.38532 WP_002209479.1.38743 WP_002209479.1.38824 WP_002209479.1.38993 WP_002209479.1.39066 WP_002209479.1.39346 WP_002209479.1.3976 WP_002209479.1.39858 WP_002209479.1.40071 WP_002209479.1.40134 WP_002209479.1.40534 WP_002209479.1.40853 WP_002209479.1.41196 WP_002209479.1.41984 WP_002209479.1.4210 WP_002209479.1.42361 WP_002209479.1.42490 WP_002209479.1.42976 WP_002209479.1.44408 WP_002209479.1.44598 WP_002209479.1.44603 WP_002209479.1.44832 WP_002209479.1.45198 WP_002209479.1.45214 WP_002209479.1.46262 WP_002209479.1.46545 WP_002209479.1.46686 WP_002209479.1.46697 WP_002209479.1.46731 WP_002209479.1.4678 WP_002209479.1.46891 WP_002209479.1.47387 WP_002209479.1.47440 WP_002209479.1.47881 WP_002209479.1.48166 WP_002209479.1.48722 WP_002209479.1.4889 WP_002209479.1.49315 WP_002209479.1.49906 WP_002209479.1.4997 WP_002209479.1.50010 WP_002209479.1.50093 WP_002209479.1.50106 WP_002209479.1.50185 WP_002209479.1.50984 WP_002209479.1.51284 WP_002209479.1.51293 WP_002209479.1.51588 WP_002209479.1.51772 WP_002209479.1.51934 WP_002209479.1.52158 WP_002209479.1.52167 WP_002209479.1.52247 WP_002209479.1.52473 WP_002209479.1.52569 WP_002209479.1.52734 WP_002209479.1.52792 WP_002209479.1.52819 WP_002209479.1.52969 WP_002209479.1.53147 WP_002209479.1.53300 WP_002209479.1.53838 WP_002209479.1.53848 WP_002209479.1.53883 WP_002209479.1.53953 WP_002209479.1.54568 WP_002209479.1.54951 WP_002209479.1.55194 WP_002209479.1.55695 WP_002209479.1.5592 WP_002209479.1.56031 WP_002209479.1.56912 WP_002209479.1.56953 WP_002209479.1.57585 WP_002209479.1.57657 WP_002209479.1.58067 WP_002209479.1.58543 WP_002209479.1.58794 WP_002209479.1.59102 WP_002209479.1.59324 WP_002209479.1.59431 WP_002209479.1.5957 WP_002209479.1.59635 WP_002209479.1.59687 WP_002209479.1.59789 WP_002209479.1.59885 WP_002209479.1.60437 WP_002209479.1.60707 WP_002209479.1.60896 WP_002209479.1.61689 WP_002209479.1.62232 WP_002209479.1.62342 WP_002209479.1.6270 WP_002209479.1.6333 WP_002209479.1.63387 WP_002209479.1.63641 WP_002209479.1.64142 WP_002209479.1.64474 WP_002209479.1.64780 WP_002209479.1.64786 WP_002209479.1.64910 WP_002209479.1.653 WP_002209479.1.65400 WP_002209479.1.65554 WP_002209479.1.6570 WP_002209479.1.65706 WP_002209479.1.65718 WP_002209479.1.6581 WP_002209479.1.66118 WP_002209479.1.66546 WP_002209479.1.66616 WP_002209479.1.67404 WP_002209479.1.67850 WP_002209479.1.6791 WP_002209479.1.68361 WP_002209479.1.68371 WP_002209479.1.68753 WP_002209479.1.68855 WP_002209479.1.69018 WP_002209479.1.69316 WP_002209479.1.69951 WP_002209479.1.70171 WP_002209479.1.70319 WP_002209479.1.70377 WP_002209479.1.70417 WP_002209479.1.70726 WP_002209479.1.7083 WP_002209479.1.7169 WP_002209479.1.71744 WP_002209479.1.72280 WP_002209479.1.72440 WP_002209479.1.72486 WP_002209479.1.7402 WP_002209479.1.74131 WP_002209479.1.74310 WP_002209479.1.74577 WP_002209479.1.74738 WP_002209479.1.75173 WP_002209479.1.7518 WP_002209479.1.75208 WP_002209479.1.75337 WP_002209479.1.75407 WP_002209479.1.75636 WP_002209479.1.75689 WP_002209479.1.75821 WP_002209479.1.76555 WP_002209479.1.76670 WP_002209479.1.77387 WP_002209479.1.77429 WP_002209479.1.77691 WP_002209479.1.78004 WP_002209479.1.7841 WP_002209479.1.78556 WP_002209479.1.79515 WP_002209479.1.79550 WP_002209479.1.79609 WP_002209479.1.79981 WP_002209479.1.8009 WP_002209479.1.80331 WP_002209479.1.81848 WP_002209479.1.81877 WP_002209479.1.8210 WP_002209479.1.82133 WP_002209479.1.82151 WP_002209479.1.82270 WP_002209479.1.82436 WP_002209479.1.82619 WP_002209479.1.8303 WP_002209479.1.83039 WP_002209479.1.83265 WP_002209479.1.83630 WP_002209479.1.8420 WP_002209479.1.84703 WP_002209479.1.84720 WP_002209479.1.85269 WP_002209479.1.85270 WP_002209479.1.8559 WP_002209479.1.85802 WP_002209479.1.86034 WP_002209479.1.86059 WP_002209479.1.86413 WP_002209479.1.87107 WP_002209479.1.8728 WP_002209479.1.87418 WP_002209479.1.8762 WP_002209479.1.87853 WP_002209479.1.87988 WP_002209479.1.88362 WP_002209479.1.88472 WP_002209479.1.89359 WP_002209479.1.89542 WP_002209479.1.8964 WP_002209479.1.90176 WP_002209479.1.9051 WP_002209479.1.90624 WP_002209479.1.91263 WP_002209479.1.91373 WP_002209479.1.91844 WP_002209479.1.92030 WP_002209479.1.92331 WP_002209479.1.92604 WP_002209479.1.927 WP_002209479.1.9311 WP_002209479.1.9320 WP_002209479.1.93623 WP_002209479.1.93928 WP_002209479.1.93933 WP_002209479.1.94052 WP_002209479.1.94201 WP_002209479.1.94545 WP_002209479.1.94683 WP_002209479.1.95746 WP_002209479.1.95981 WP_002209479.1.97245 WP_002209479.1.97375 WP_002209479.1.97448 WP_002209479.1.97791 WP_002209479.1.97864 WP_002209479.1.97872 WP_002209479.1.97894 WP_002209479.1.99109 WP_002209479.1.99383 WP_002209479.1.9941 WP_002209479.1.99416 WP_002209479.1.99788 WP_002209479.1.99882 WP_002209479.1.99990 YP_002348791.1.25044 gi|384138230|ref|YP_005520932.1| gi|153949361|ref|YP_001399136.1| gi|108810217|ref|YP_645984.1| gi|186893469|ref|YP_001870581.1| gi|108806104|ref|YP_650020.1| gi|45442886|ref|NP_994425.1| gi|170026287|ref|YP_001722792.1| gi|145600775|ref|YP_001164851.1| gi|384124037|ref|YP_005506657.1| gi|384127899|ref|YP_005510513.1| gi|218930916|ref|YP_002348791.1| gi|294505566|ref|YP_003569628.1| gi|22124236|ref|NP_667659.1| gi|384412982|ref|YP_005622344.1| gi|51594477|ref|YP_068668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]