SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294503312|ref|YP_003567374.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294503312|ref|YP_003567374.1|
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.46e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.59e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294503312|ref|YP_003567374.1|
Sequence length 206
Comment putative glutathione S-transferase-family protein [Yersinia pestis Z176003]
Sequence
MLTVWGRNNSTNVKKVLWCLEELGIPYQRIDVGGQYGKLNDPQYRALNPNGLIPCLQDKD
FILWESNTIVRYLAAQYGQNSLYLADHHQRASAEKWMDWATSSVVEPFKAVFIGLVRTPP
EQQDKVKIAQGMEKMNTLMSIANDALGEQAYLSGDAFGIGDIPLGCLAYAWFNLPIERPE
LPHLQRWYQSLTQRIAFQKVIAIGLS
Download sequence
Identical sequences A0A0E1NLP6 A0A0H2YKU5 A0A0M1VCS5 A0A0U1EPS7 A0A208SBL0 Q0WH99
gi|384125447|ref|YP_005508061.1| gi|218928464|ref|YP_002346339.1| gi|384141021|ref|YP_005523723.1| gi|384121755|ref|YP_005504375.1| gi|186894758|ref|YP_001871870.1| gi|108812826|ref|YP_648593.1| gi|108807027|ref|YP_650943.1| 214092.YPO1314 349746.YpAngola_A1542 360102.YPA_1031 377628.YPN_2665 386656.YPDSF_2382 502801.YPTS_1441 gi|162420823|ref|YP_001606051.1| gi|294503312|ref|YP_003567374.1| WP_002208781.1.100083 WP_002208781.1.100246 WP_002208781.1.100593 WP_002208781.1.100921 WP_002208781.1.100931 WP_002208781.1.10105 WP_002208781.1.101305 WP_002208781.1.101382 WP_002208781.1.101928 WP_002208781.1.102012 WP_002208781.1.102067 WP_002208781.1.10736 WP_002208781.1.10935 WP_002208781.1.10955 WP_002208781.1.11693 WP_002208781.1.12463 WP_002208781.1.12857 WP_002208781.1.1388 WP_002208781.1.14063 WP_002208781.1.14804 WP_002208781.1.15321 WP_002208781.1.15555 WP_002208781.1.15605 WP_002208781.1.15689 WP_002208781.1.16243 WP_002208781.1.16333 WP_002208781.1.17135 WP_002208781.1.17141 WP_002208781.1.17608 WP_002208781.1.17873 WP_002208781.1.17983 WP_002208781.1.18208 WP_002208781.1.18640 WP_002208781.1.19329 WP_002208781.1.19425 WP_002208781.1.19739 WP_002208781.1.19763 WP_002208781.1.20035 WP_002208781.1.20380 WP_002208781.1.2064 WP_002208781.1.20932 WP_002208781.1.21486 WP_002208781.1.21784 WP_002208781.1.21879 WP_002208781.1.21934 WP_002208781.1.22530 WP_002208781.1.22542 WP_002208781.1.22708 WP_002208781.1.23157 WP_002208781.1.23271 WP_002208781.1.23687 WP_002208781.1.23811 WP_002208781.1.24002 WP_002208781.1.2451 WP_002208781.1.25181 WP_002208781.1.25394 WP_002208781.1.2640 WP_002208781.1.26776 WP_002208781.1.26960 WP_002208781.1.27124 WP_002208781.1.27251 WP_002208781.1.2726 WP_002208781.1.28647 WP_002208781.1.28922 WP_002208781.1.29157 WP_002208781.1.29355 WP_002208781.1.2947 WP_002208781.1.29622 WP_002208781.1.2964 WP_002208781.1.29685 WP_002208781.1.29814 WP_002208781.1.3092 WP_002208781.1.30931 WP_002208781.1.311 WP_002208781.1.31496 WP_002208781.1.31739 WP_002208781.1.31805 WP_002208781.1.32343 WP_002208781.1.32388 WP_002208781.1.32446 WP_002208781.1.32736 WP_002208781.1.33203 WP_002208781.1.33324 WP_002208781.1.33661 WP_002208781.1.33937 WP_002208781.1.34031 WP_002208781.1.34138 WP_002208781.1.35389 WP_002208781.1.35538 WP_002208781.1.36088 WP_002208781.1.37174 WP_002208781.1.37494 WP_002208781.1.37863 WP_002208781.1.38147 WP_002208781.1.38235 WP_002208781.1.38532 WP_002208781.1.38743 WP_002208781.1.38824 WP_002208781.1.38993 WP_002208781.1.39066 WP_002208781.1.39346 WP_002208781.1.3976 WP_002208781.1.39858 WP_002208781.1.40071 WP_002208781.1.40134 WP_002208781.1.40853 WP_002208781.1.41196 WP_002208781.1.4210 WP_002208781.1.42361 WP_002208781.1.42490 WP_002208781.1.44408 WP_002208781.1.44598 WP_002208781.1.44603 WP_002208781.1.44832 WP_002208781.1.45198 WP_002208781.1.45214 WP_002208781.1.46262 WP_002208781.1.46545 WP_002208781.1.46686 WP_002208781.1.46697 WP_002208781.1.46731 WP_002208781.1.4678 WP_002208781.1.46891 WP_002208781.1.47387 WP_002208781.1.47440 WP_002208781.1.48166 WP_002208781.1.48722 WP_002208781.1.4889 WP_002208781.1.49906 WP_002208781.1.4997 WP_002208781.1.50010 WP_002208781.1.50093 WP_002208781.1.51284 WP_002208781.1.51293 WP_002208781.1.51588 WP_002208781.1.51772 WP_002208781.1.51934 WP_002208781.1.52158 WP_002208781.1.52247 WP_002208781.1.52734 WP_002208781.1.52819 WP_002208781.1.52969 WP_002208781.1.53300 WP_002208781.1.53838 WP_002208781.1.53848 WP_002208781.1.53953 WP_002208781.1.54568 WP_002208781.1.54951 WP_002208781.1.55194 WP_002208781.1.55695 WP_002208781.1.5592 WP_002208781.1.56031 WP_002208781.1.56912 WP_002208781.1.56953 WP_002208781.1.57585 WP_002208781.1.57657 WP_002208781.1.58067 WP_002208781.1.58794 WP_002208781.1.59102 WP_002208781.1.59431 WP_002208781.1.5957 WP_002208781.1.59635 WP_002208781.1.59687 WP_002208781.1.59789 WP_002208781.1.59885 WP_002208781.1.60437 WP_002208781.1.60707 WP_002208781.1.60896 WP_002208781.1.61689 WP_002208781.1.62232 WP_002208781.1.62342 WP_002208781.1.6270 WP_002208781.1.63387 WP_002208781.1.63641 WP_002208781.1.64142 WP_002208781.1.64474 WP_002208781.1.64780 WP_002208781.1.64786 WP_002208781.1.64910 WP_002208781.1.65400 WP_002208781.1.65554 WP_002208781.1.6570 WP_002208781.1.65706 WP_002208781.1.65718 WP_002208781.1.6581 WP_002208781.1.66118 WP_002208781.1.66546 WP_002208781.1.66616 WP_002208781.1.67404 WP_002208781.1.67850 WP_002208781.1.6791 WP_002208781.1.68361 WP_002208781.1.68371 WP_002208781.1.68753 WP_002208781.1.68855 WP_002208781.1.69018 WP_002208781.1.69316 WP_002208781.1.69951 WP_002208781.1.70117 WP_002208781.1.70171 WP_002208781.1.70319 WP_002208781.1.70377 WP_002208781.1.70417 WP_002208781.1.70726 WP_002208781.1.7083 WP_002208781.1.7169 WP_002208781.1.71744 WP_002208781.1.72280 WP_002208781.1.72440 WP_002208781.1.72486 WP_002208781.1.7402 WP_002208781.1.74310 WP_002208781.1.74577 WP_002208781.1.74738 WP_002208781.1.75173 WP_002208781.1.7518 WP_002208781.1.75208 WP_002208781.1.75337 WP_002208781.1.75407 WP_002208781.1.75636 WP_002208781.1.75689 WP_002208781.1.75821 WP_002208781.1.76555 WP_002208781.1.76670 WP_002208781.1.77387 WP_002208781.1.77429 WP_002208781.1.77691 WP_002208781.1.78004 WP_002208781.1.7841 WP_002208781.1.78556 WP_002208781.1.79515 WP_002208781.1.79550 WP_002208781.1.79609 WP_002208781.1.79981 WP_002208781.1.8009 WP_002208781.1.80331 WP_002208781.1.81848 WP_002208781.1.81877 WP_002208781.1.8210 WP_002208781.1.82133 WP_002208781.1.82151 WP_002208781.1.82270 WP_002208781.1.82436 WP_002208781.1.82619 WP_002208781.1.8303 WP_002208781.1.83039 WP_002208781.1.83265 WP_002208781.1.83630 WP_002208781.1.8420 WP_002208781.1.84703 WP_002208781.1.84720 WP_002208781.1.85269 WP_002208781.1.85270 WP_002208781.1.8559 WP_002208781.1.85802 WP_002208781.1.86034 WP_002208781.1.86413 WP_002208781.1.87107 WP_002208781.1.8728 WP_002208781.1.87418 WP_002208781.1.8762 WP_002208781.1.87853 WP_002208781.1.87988 WP_002208781.1.88362 WP_002208781.1.88472 WP_002208781.1.89359 WP_002208781.1.8964 WP_002208781.1.90176 WP_002208781.1.9051 WP_002208781.1.90624 WP_002208781.1.91844 WP_002208781.1.92030 WP_002208781.1.92331 WP_002208781.1.92604 WP_002208781.1.927 WP_002208781.1.9311 WP_002208781.1.9320 WP_002208781.1.93623 WP_002208781.1.93928 WP_002208781.1.93933 WP_002208781.1.94052 WP_002208781.1.94201 WP_002208781.1.94545 WP_002208781.1.94683 WP_002208781.1.95746 WP_002208781.1.95981 WP_002208781.1.97245 WP_002208781.1.97375 WP_002208781.1.97448 WP_002208781.1.97791 WP_002208781.1.97864 WP_002208781.1.97872 WP_002208781.1.97894 WP_002208781.1.99109 WP_002208781.1.99383 WP_002208781.1.9941 WP_002208781.1.99416 WP_002208781.1.99788 WP_002208781.1.99990 YP_002346339.1.25044 gi|384415333|ref|YP_005624695.1| gi|145599654|ref|YP_001163730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]