SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294503626|ref|YP_003567688.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294503626|ref|YP_003567688.1|
Domain Number 1 Region: 84-199
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.06e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.0000258
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.12e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.0000459
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294503626|ref|YP_003567688.1|
Sequence length 201
Comment glutathione S-transferase [Yersinia pestis Z176003]
Sequence
MKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATELHKGFSPLFNPNTPDE
YKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSRWANALNLQIKERSHLDQ
YMARVAERPAVKAALAAEDIK
Download sequence
Identical sequences A0A0H2YH27 A0A0H3B3E0 A0A0M1V601 A0A0U1EMU7 A0A0U1QVN6 A0A208S1K2 A0A2A7VES6 Q0WEF5 Q66A51
gi|170024122|ref|YP_001720627.1| gi|384139806|ref|YP_005522508.1| gi|51596605|ref|YP_070796.1| WP_002210962.1.100083 WP_002210962.1.100246 WP_002210962.1.100593 WP_002210962.1.10066 WP_002210962.1.100921 WP_002210962.1.100931 WP_002210962.1.101305 WP_002210962.1.101382 WP_002210962.1.102012 WP_002210962.1.102067 WP_002210962.1.10736 WP_002210962.1.10935 WP_002210962.1.10955 WP_002210962.1.11693 WP_002210962.1.12167 WP_002210962.1.12463 WP_002210962.1.12736 WP_002210962.1.1388 WP_002210962.1.14063 WP_002210962.1.14169 WP_002210962.1.14804 WP_002210962.1.15321 WP_002210962.1.15555 WP_002210962.1.15605 WP_002210962.1.15689 WP_002210962.1.16243 WP_002210962.1.16333 WP_002210962.1.17135 WP_002210962.1.17141 WP_002210962.1.17608 WP_002210962.1.17873 WP_002210962.1.17983 WP_002210962.1.18208 WP_002210962.1.18640 WP_002210962.1.18826 WP_002210962.1.19329 WP_002210962.1.19425 WP_002210962.1.19739 WP_002210962.1.19763 WP_002210962.1.20035 WP_002210962.1.20380 WP_002210962.1.20547 WP_002210962.1.2064 WP_002210962.1.20932 WP_002210962.1.21784 WP_002210962.1.21879 WP_002210962.1.21934 WP_002210962.1.22530 WP_002210962.1.22542 WP_002210962.1.22708 WP_002210962.1.23157 WP_002210962.1.23271 WP_002210962.1.23687 WP_002210962.1.23811 WP_002210962.1.24002 WP_002210962.1.2451 WP_002210962.1.24517 WP_002210962.1.25181 WP_002210962.1.25394 WP_002210962.1.26383 WP_002210962.1.2640 WP_002210962.1.26776 WP_002210962.1.26960 WP_002210962.1.27124 WP_002210962.1.27251 WP_002210962.1.2726 WP_002210962.1.28647 WP_002210962.1.28922 WP_002210962.1.29186 WP_002210962.1.29355 WP_002210962.1.2947 WP_002210962.1.29622 WP_002210962.1.2964 WP_002210962.1.29685 WP_002210962.1.29814 WP_002210962.1.3092 WP_002210962.1.30931 WP_002210962.1.311 WP_002210962.1.31336 WP_002210962.1.31496 WP_002210962.1.31721 WP_002210962.1.31739 WP_002210962.1.31805 WP_002210962.1.32343 WP_002210962.1.32388 WP_002210962.1.32446 WP_002210962.1.32736 WP_002210962.1.33203 WP_002210962.1.33324 WP_002210962.1.33661 WP_002210962.1.33775 WP_002210962.1.33937 WP_002210962.1.34031 WP_002210962.1.34138 WP_002210962.1.35389 WP_002210962.1.35538 WP_002210962.1.36088 WP_002210962.1.37174 WP_002210962.1.37494 WP_002210962.1.37863 WP_002210962.1.38147 WP_002210962.1.38235 WP_002210962.1.38743 WP_002210962.1.38824 WP_002210962.1.38993 WP_002210962.1.39066 WP_002210962.1.39346 WP_002210962.1.3976 WP_002210962.1.39858 WP_002210962.1.40071 WP_002210962.1.40134 WP_002210962.1.40534 WP_002210962.1.40853 WP_002210962.1.41196 WP_002210962.1.4210 WP_002210962.1.42361 WP_002210962.1.42490 WP_002210962.1.42976 WP_002210962.1.44408 WP_002210962.1.44598 WP_002210962.1.44832 WP_002210962.1.45198 WP_002210962.1.45214 WP_002210962.1.46262 WP_002210962.1.46545 WP_002210962.1.46686 WP_002210962.1.46697 WP_002210962.1.46731 WP_002210962.1.4678 WP_002210962.1.46891 WP_002210962.1.47387 WP_002210962.1.47440 WP_002210962.1.47769 WP_002210962.1.47881 WP_002210962.1.48166 WP_002210962.1.48722 WP_002210962.1.4889 WP_002210962.1.49315 WP_002210962.1.49906 WP_002210962.1.4997 WP_002210962.1.50010 WP_002210962.1.50093 WP_002210962.1.50106 WP_002210962.1.50185 WP_002210962.1.50984 WP_002210962.1.51284 WP_002210962.1.51772 WP_002210962.1.51934 WP_002210962.1.52158 WP_002210962.1.52247 WP_002210962.1.52473 WP_002210962.1.52734 WP_002210962.1.52792 WP_002210962.1.52819 WP_002210962.1.52969 WP_002210962.1.53147 WP_002210962.1.53300 WP_002210962.1.53838 WP_002210962.1.53848 WP_002210962.1.53883 WP_002210962.1.53953 WP_002210962.1.54951 WP_002210962.1.55194 WP_002210962.1.55695 WP_002210962.1.5592 WP_002210962.1.56031 WP_002210962.1.56912 WP_002210962.1.56953 WP_002210962.1.57585 WP_002210962.1.57657 WP_002210962.1.58067 WP_002210962.1.58543 WP_002210962.1.58794 WP_002210962.1.59102 WP_002210962.1.59431 WP_002210962.1.5957 WP_002210962.1.59635 WP_002210962.1.5968 WP_002210962.1.59687 WP_002210962.1.59789 WP_002210962.1.59885 WP_002210962.1.60437 WP_002210962.1.60707 WP_002210962.1.60896 WP_002210962.1.61689 WP_002210962.1.62232 WP_002210962.1.62342 WP_002210962.1.6270 WP_002210962.1.6333 WP_002210962.1.63387 WP_002210962.1.63641 WP_002210962.1.64474 WP_002210962.1.64780 WP_002210962.1.64910 WP_002210962.1.653 WP_002210962.1.65400 WP_002210962.1.6570 WP_002210962.1.65706 WP_002210962.1.65718 WP_002210962.1.6581 WP_002210962.1.66118 WP_002210962.1.66546 WP_002210962.1.66616 WP_002210962.1.67404 WP_002210962.1.67850 WP_002210962.1.6791 WP_002210962.1.68361 WP_002210962.1.68753 WP_002210962.1.68855 WP_002210962.1.69018 WP_002210962.1.69316 WP_002210962.1.69951 WP_002210962.1.70117 WP_002210962.1.70171 WP_002210962.1.70319 WP_002210962.1.70377 WP_002210962.1.70417 WP_002210962.1.7083 WP_002210962.1.7169 WP_002210962.1.71744 WP_002210962.1.72280 WP_002210962.1.72440 WP_002210962.1.72486 WP_002210962.1.7402 WP_002210962.1.74131 WP_002210962.1.74310 WP_002210962.1.74577 WP_002210962.1.74738 WP_002210962.1.75169 WP_002210962.1.75208 WP_002210962.1.75337 WP_002210962.1.75407 WP_002210962.1.75636 WP_002210962.1.75689 WP_002210962.1.75821 WP_002210962.1.76670 WP_002210962.1.77295 WP_002210962.1.77387 WP_002210962.1.77429 WP_002210962.1.77569 WP_002210962.1.77691 WP_002210962.1.78004 WP_002210962.1.7841 WP_002210962.1.78556 WP_002210962.1.79515 WP_002210962.1.79550 WP_002210962.1.79609 WP_002210962.1.79825 WP_002210962.1.79981 WP_002210962.1.8009 WP_002210962.1.80331 WP_002210962.1.81877 WP_002210962.1.8210 WP_002210962.1.82133 WP_002210962.1.82151 WP_002210962.1.82270 WP_002210962.1.82619 WP_002210962.1.8303 WP_002210962.1.83039 WP_002210962.1.83265 WP_002210962.1.83630 WP_002210962.1.8420 WP_002210962.1.84703 WP_002210962.1.85269 WP_002210962.1.85270 WP_002210962.1.8559 WP_002210962.1.85802 WP_002210962.1.86034 WP_002210962.1.86059 WP_002210962.1.86413 WP_002210962.1.87107 WP_002210962.1.8728 WP_002210962.1.87418 WP_002210962.1.8762 WP_002210962.1.87853 WP_002210962.1.87988 WP_002210962.1.88362 WP_002210962.1.88472 WP_002210962.1.89359 WP_002210962.1.89542 WP_002210962.1.8964 WP_002210962.1.90176 WP_002210962.1.9051 WP_002210962.1.90624 WP_002210962.1.91263 WP_002210962.1.91373 WP_002210962.1.91844 WP_002210962.1.92030 WP_002210962.1.92331 WP_002210962.1.92604 WP_002210962.1.927 WP_002210962.1.9311 WP_002210962.1.9320 WP_002210962.1.93623 WP_002210962.1.93928 WP_002210962.1.93933 WP_002210962.1.94052 WP_002210962.1.94545 WP_002210962.1.95746 WP_002210962.1.95981 WP_002210962.1.97245 WP_002210962.1.97375 WP_002210962.1.97791 WP_002210962.1.97864 WP_002210962.1.97872 WP_002210962.1.97894 WP_002210962.1.99109 WP_002210962.1.99383 WP_002210962.1.9941 WP_002210962.1.99416 WP_002210962.1.99788 WP_002210962.1.99882 WP_002210962.1.99972 WP_002210962.1.99990 YP_002347333.1.25044 gi|186895664|ref|YP_001872776.1| gi|218929458|ref|YP_002347333.1| gi|162421535|ref|YP_001606964.1| gi|384125927|ref|YP_005508541.1| gi|384122073|ref|YP_005504693.1| 214092.YPO2367 273123.YPTB2281 349746.YpAngola_A2552 349747.YpsIP31758_1775 377628.YPN_1824 386656.YPDSF_0779 502800.YPK_1883 502801.YPTS_2358 gi|145598082|ref|YP_001162158.1| gi|153947620|ref|YP_001400750.1| gi|384414517|ref|YP_005623879.1| gi|294503626|ref|YP_003567688.1| gi|108811986|ref|YP_647753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]