SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294505237|ref|YP_003569299.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294505237|ref|YP_003569299.1|
Domain Number 1 Region: 118-153,182-260
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.75e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 40-132
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.68e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294505237|ref|YP_003569299.1|
Sequence length 284
Comment putative glutathione S-transferase [Yersinia pestis Z176003]
Sequence
MMKDNEYQPPKIWTENNASGGVWSKINRPTAGARYEADLPVGKHPLQLYSMGTPNGQKVT
ILLEELLALGEKGAEYDAHLIRISEGEQFSSGFVSINPNSKIPALMDYSSTPPVRVFESG
AILLYLADKFGHFLPKSHAARTEALNWLFWLQGAAPYLGGGFGHFYHYAPVKIEYAIDRF
TMEAKRQLDLLNTQLKTHEYIAGDEYTIADIAIWPWYGSLVLGLQYEAGEFLDVKSYPHL
IRWTETIAKRPAVQRGRIVNRTWGAPEEQLPERHDAADFDRLIK
Download sequence
Identical sequences A0A0H2YD43 A0A0H2YN14 A0A0M1V9Q1 A0A208S4D3 Q0WB14 Q7CL53
gi|294505237|ref|YP_003569299.1| gi|45443637|ref|NP_995176.1| WP_002210049.1.100083 WP_002210049.1.100246 WP_002210049.1.100921 WP_002210049.1.100931 WP_002210049.1.10105 WP_002210049.1.101305 WP_002210049.1.101382 WP_002210049.1.101928 WP_002210049.1.102012 WP_002210049.1.102067 WP_002210049.1.10736 WP_002210049.1.10935 WP_002210049.1.10955 WP_002210049.1.11693 WP_002210049.1.12463 WP_002210049.1.12736 WP_002210049.1.12857 WP_002210049.1.1388 WP_002210049.1.14063 WP_002210049.1.14804 WP_002210049.1.15321 WP_002210049.1.15555 WP_002210049.1.15605 WP_002210049.1.15689 WP_002210049.1.16243 WP_002210049.1.16333 WP_002210049.1.17135 WP_002210049.1.17141 WP_002210049.1.17608 WP_002210049.1.17873 WP_002210049.1.17983 WP_002210049.1.18208 WP_002210049.1.18640 WP_002210049.1.18826 WP_002210049.1.19329 WP_002210049.1.19425 WP_002210049.1.19739 WP_002210049.1.19763 WP_002210049.1.20035 WP_002210049.1.2064 WP_002210049.1.21486 WP_002210049.1.21784 WP_002210049.1.21879 WP_002210049.1.21934 WP_002210049.1.22542 WP_002210049.1.22708 WP_002210049.1.23157 WP_002210049.1.23271 WP_002210049.1.23687 WP_002210049.1.23811 WP_002210049.1.24002 WP_002210049.1.2451 WP_002210049.1.25181 WP_002210049.1.25394 WP_002210049.1.2640 WP_002210049.1.26776 WP_002210049.1.26960 WP_002210049.1.27124 WP_002210049.1.27251 WP_002210049.1.2726 WP_002210049.1.28647 WP_002210049.1.28922 WP_002210049.1.29157 WP_002210049.1.29355 WP_002210049.1.2947 WP_002210049.1.29622 WP_002210049.1.2964 WP_002210049.1.29685 WP_002210049.1.29814 WP_002210049.1.3092 WP_002210049.1.30931 WP_002210049.1.311 WP_002210049.1.31336 WP_002210049.1.31496 WP_002210049.1.31739 WP_002210049.1.31805 WP_002210049.1.32343 WP_002210049.1.32388 WP_002210049.1.32446 WP_002210049.1.33203 WP_002210049.1.33661 WP_002210049.1.33937 WP_002210049.1.34031 WP_002210049.1.34138 WP_002210049.1.35389 WP_002210049.1.35538 WP_002210049.1.36088 WP_002210049.1.37174 WP_002210049.1.37494 WP_002210049.1.37863 WP_002210049.1.38147 WP_002210049.1.38235 WP_002210049.1.38743 WP_002210049.1.38824 WP_002210049.1.38993 WP_002210049.1.39346 WP_002210049.1.3976 WP_002210049.1.40071 WP_002210049.1.40134 WP_002210049.1.40534 WP_002210049.1.40853 WP_002210049.1.41196 WP_002210049.1.4210 WP_002210049.1.42490 WP_002210049.1.44408 WP_002210049.1.44598 WP_002210049.1.44603 WP_002210049.1.45198 WP_002210049.1.45214 WP_002210049.1.46262 WP_002210049.1.46545 WP_002210049.1.46686 WP_002210049.1.46731 WP_002210049.1.4678 WP_002210049.1.46891 WP_002210049.1.47387 WP_002210049.1.47440 WP_002210049.1.48166 WP_002210049.1.48722 WP_002210049.1.4889 WP_002210049.1.49906 WP_002210049.1.4997 WP_002210049.1.50010 WP_002210049.1.50093 WP_002210049.1.50106 WP_002210049.1.50984 WP_002210049.1.51284 WP_002210049.1.51293 WP_002210049.1.51588 WP_002210049.1.51772 WP_002210049.1.51934 WP_002210049.1.52158 WP_002210049.1.52734 WP_002210049.1.52819 WP_002210049.1.52969 WP_002210049.1.53300 WP_002210049.1.53838 WP_002210049.1.53848 WP_002210049.1.53953 WP_002210049.1.54568 WP_002210049.1.54951 WP_002210049.1.55194 WP_002210049.1.55695 WP_002210049.1.5592 WP_002210049.1.56031 WP_002210049.1.56912 WP_002210049.1.56953 WP_002210049.1.57585 WP_002210049.1.57657 WP_002210049.1.58067 WP_002210049.1.58794 WP_002210049.1.59102 WP_002210049.1.59431 WP_002210049.1.5957 WP_002210049.1.59635 WP_002210049.1.59687 WP_002210049.1.59789 WP_002210049.1.59885 WP_002210049.1.60437 WP_002210049.1.60707 WP_002210049.1.60896 WP_002210049.1.61689 WP_002210049.1.62232 WP_002210049.1.62342 WP_002210049.1.6270 WP_002210049.1.63387 WP_002210049.1.64142 WP_002210049.1.64474 WP_002210049.1.64786 WP_002210049.1.64910 WP_002210049.1.653 WP_002210049.1.65400 WP_002210049.1.65554 WP_002210049.1.6570 WP_002210049.1.65706 WP_002210049.1.65718 WP_002210049.1.6581 WP_002210049.1.66546 WP_002210049.1.66616 WP_002210049.1.67404 WP_002210049.1.68361 WP_002210049.1.68753 WP_002210049.1.68855 WP_002210049.1.69018 WP_002210049.1.69316 WP_002210049.1.69951 WP_002210049.1.70117 WP_002210049.1.70171 WP_002210049.1.70319 WP_002210049.1.70377 WP_002210049.1.70417 WP_002210049.1.70726 WP_002210049.1.7083 WP_002210049.1.7169 WP_002210049.1.71744 WP_002210049.1.72280 WP_002210049.1.72440 WP_002210049.1.72486 WP_002210049.1.7402 WP_002210049.1.74131 WP_002210049.1.74577 WP_002210049.1.74738 WP_002210049.1.75173 WP_002210049.1.7518 WP_002210049.1.75337 WP_002210049.1.75407 WP_002210049.1.75636 WP_002210049.1.75821 WP_002210049.1.76670 WP_002210049.1.77387 WP_002210049.1.77429 WP_002210049.1.77691 WP_002210049.1.78004 WP_002210049.1.7841 WP_002210049.1.78556 WP_002210049.1.79515 WP_002210049.1.79550 WP_002210049.1.79609 WP_002210049.1.79981 WP_002210049.1.8009 WP_002210049.1.80331 WP_002210049.1.81848 WP_002210049.1.81877 WP_002210049.1.8210 WP_002210049.1.82133 WP_002210049.1.82151 WP_002210049.1.82270 WP_002210049.1.82619 WP_002210049.1.8303 WP_002210049.1.83039 WP_002210049.1.83265 WP_002210049.1.8420 WP_002210049.1.84703 WP_002210049.1.84720 WP_002210049.1.85269 WP_002210049.1.8559 WP_002210049.1.85802 WP_002210049.1.86034 WP_002210049.1.86413 WP_002210049.1.87107 WP_002210049.1.87418 WP_002210049.1.8762 WP_002210049.1.87853 WP_002210049.1.87988 WP_002210049.1.88362 WP_002210049.1.88472 WP_002210049.1.89359 WP_002210049.1.8964 WP_002210049.1.90176 WP_002210049.1.9051 WP_002210049.1.90624 WP_002210049.1.91373 WP_002210049.1.92030 WP_002210049.1.92331 WP_002210049.1.92604 WP_002210049.1.927 WP_002210049.1.9311 WP_002210049.1.9320 WP_002210049.1.93623 WP_002210049.1.93928 WP_002210049.1.93933 WP_002210049.1.94052 WP_002210049.1.94201 WP_002210049.1.94545 WP_002210049.1.94683 WP_002210049.1.95746 WP_002210049.1.95981 WP_002210049.1.97245 WP_002210049.1.97375 WP_002210049.1.97448 WP_002210049.1.97791 WP_002210049.1.97864 WP_002210049.1.97872 WP_002210049.1.97894 WP_002210049.1.99109 WP_002210049.1.9941 WP_002210049.1.99416 WP_002210049.1.99788 WP_002210049.1.99990 YP_002348524.1.25044 gi|162419093|ref|YP_001605766.1| IDP01774 gi|384127658|ref|YP_005510272.1| gi|384123703|ref|YP_005506323.1| gi|108809643|ref|YP_653559.1| gi|384138495|ref|YP_005521197.1| gi|145597562|ref|YP_001161638.1| gi|108813691|ref|YP_649458.1| 187410.y0229 214092.YPO3639 229193.YP_3908 349746.YpAngola_A1225 360102.YPA_3652 377628.YPN_3531 386656.YPDSF_0246 gi|22124149|ref|NP_667572.1| gi|218930649|ref|YP_002348524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]