SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294505316|ref|YP_003569378.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294505316|ref|YP_003569378.1|
Domain Number 1 Region: 21-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.27e-30
Family SCOPe 0.0012
Further Details:      
 
Domain Number 2 Region: 88-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.56e-29
Family SCOPe 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294505316|ref|YP_003569378.1|
Sequence length 213
Comment stringent starvation protein A [Yersinia pestis Z176003]
Sequence
MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADNLPQDLIDLNPYRTVP
TLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMHRIEHDWYSLLYKIEQG
NAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAPLLWRLPVLGIEFTGAGS
KELKGYMTRVFERDAFLASLTEAEREMHLKTRS
Download sequence
Identical sequences A0A0E1NQB5 A0A0E8XLK8 A0A0H2YL94 A0A0H3B115 A0A0M1V9N7 A0A0T9JGJ9 A0A0U1EX80 A0A208RX23 Q0WB90 Q665L1 Q7CL96
gi|218930573|ref|YP_002348448.1| WP_002210135.1.100083 WP_002210135.1.100246 WP_002210135.1.100593 WP_002210135.1.10066 WP_002210135.1.100921 WP_002210135.1.100931 WP_002210135.1.10105 WP_002210135.1.101305 WP_002210135.1.101382 WP_002210135.1.101928 WP_002210135.1.102012 WP_002210135.1.102067 WP_002210135.1.10736 WP_002210135.1.10935 WP_002210135.1.10955 WP_002210135.1.11693 WP_002210135.1.12167 WP_002210135.1.12463 WP_002210135.1.12736 WP_002210135.1.12857 WP_002210135.1.1388 WP_002210135.1.14063 WP_002210135.1.14169 WP_002210135.1.15321 WP_002210135.1.15555 WP_002210135.1.15605 WP_002210135.1.15689 WP_002210135.1.16243 WP_002210135.1.17135 WP_002210135.1.17141 WP_002210135.1.17608 WP_002210135.1.17873 WP_002210135.1.17983 WP_002210135.1.18208 WP_002210135.1.18640 WP_002210135.1.18826 WP_002210135.1.19329 WP_002210135.1.19425 WP_002210135.1.19739 WP_002210135.1.19763 WP_002210135.1.20035 WP_002210135.1.20380 WP_002210135.1.20547 WP_002210135.1.2064 WP_002210135.1.20932 WP_002210135.1.21486 WP_002210135.1.21784 WP_002210135.1.21879 WP_002210135.1.21934 WP_002210135.1.22530 WP_002210135.1.22542 WP_002210135.1.22708 WP_002210135.1.23271 WP_002210135.1.23687 WP_002210135.1.23811 WP_002210135.1.24002 WP_002210135.1.2451 WP_002210135.1.24517 WP_002210135.1.25181 WP_002210135.1.25394 WP_002210135.1.26383 WP_002210135.1.2640 WP_002210135.1.26509 WP_002210135.1.26776 WP_002210135.1.26960 WP_002210135.1.27124 WP_002210135.1.27251 WP_002210135.1.2726 WP_002210135.1.28922 WP_002210135.1.29157 WP_002210135.1.29186 WP_002210135.1.29355 WP_002210135.1.2947 WP_002210135.1.29622 WP_002210135.1.2964 WP_002210135.1.29685 WP_002210135.1.29814 WP_002210135.1.3092 WP_002210135.1.30931 WP_002210135.1.311 WP_002210135.1.31336 WP_002210135.1.31496 WP_002210135.1.31721 WP_002210135.1.31739 WP_002210135.1.31805 WP_002210135.1.32343 WP_002210135.1.32388 WP_002210135.1.32446 WP_002210135.1.32736 WP_002210135.1.33203 WP_002210135.1.33324 WP_002210135.1.33661 WP_002210135.1.33775 WP_002210135.1.33937 WP_002210135.1.34031 WP_002210135.1.34138 WP_002210135.1.35389 WP_002210135.1.35538 WP_002210135.1.36088 WP_002210135.1.37174 WP_002210135.1.37494 WP_002210135.1.37863 WP_002210135.1.38147 WP_002210135.1.38235 WP_002210135.1.38532 WP_002210135.1.38743 WP_002210135.1.38824 WP_002210135.1.38993 WP_002210135.1.39066 WP_002210135.1.39346 WP_002210135.1.3976 WP_002210135.1.39858 WP_002210135.1.40071 WP_002210135.1.40134 WP_002210135.1.40534 WP_002210135.1.40853 WP_002210135.1.41196 WP_002210135.1.41984 WP_002210135.1.42361 WP_002210135.1.42490 WP_002210135.1.42976 WP_002210135.1.44408 WP_002210135.1.44598 WP_002210135.1.44603 WP_002210135.1.44832 WP_002210135.1.45214 WP_002210135.1.46262 WP_002210135.1.46545 WP_002210135.1.46686 WP_002210135.1.46697 WP_002210135.1.46731 WP_002210135.1.4678 WP_002210135.1.46891 WP_002210135.1.47387 WP_002210135.1.47440 WP_002210135.1.47769 WP_002210135.1.47881 WP_002210135.1.48166 WP_002210135.1.48722 WP_002210135.1.49315 WP_002210135.1.49906 WP_002210135.1.4997 WP_002210135.1.50010 WP_002210135.1.50093 WP_002210135.1.50106 WP_002210135.1.50185 WP_002210135.1.50984 WP_002210135.1.51284 WP_002210135.1.51293 WP_002210135.1.51588 WP_002210135.1.51772 WP_002210135.1.51934 WP_002210135.1.52158 WP_002210135.1.52247 WP_002210135.1.52473 WP_002210135.1.52569 WP_002210135.1.52734 WP_002210135.1.52792 WP_002210135.1.52819 WP_002210135.1.53147 WP_002210135.1.53300 WP_002210135.1.53838 WP_002210135.1.53848 WP_002210135.1.53883 WP_002210135.1.53953 WP_002210135.1.54568 WP_002210135.1.54951 WP_002210135.1.55194 WP_002210135.1.55695 WP_002210135.1.5592 WP_002210135.1.56031 WP_002210135.1.56912 WP_002210135.1.56953 WP_002210135.1.57585 WP_002210135.1.57657 WP_002210135.1.58067 WP_002210135.1.58794 WP_002210135.1.59102 WP_002210135.1.59431 WP_002210135.1.5957 WP_002210135.1.59635 WP_002210135.1.5968 WP_002210135.1.59687 WP_002210135.1.59789 WP_002210135.1.59885 WP_002210135.1.60437 WP_002210135.1.60707 WP_002210135.1.60896 WP_002210135.1.61689 WP_002210135.1.62232 WP_002210135.1.62342 WP_002210135.1.6270 WP_002210135.1.6333 WP_002210135.1.63387 WP_002210135.1.63517 WP_002210135.1.63641 WP_002210135.1.64142 WP_002210135.1.64474 WP_002210135.1.64780 WP_002210135.1.64786 WP_002210135.1.64910 WP_002210135.1.653 WP_002210135.1.65400 WP_002210135.1.65554 WP_002210135.1.6570 WP_002210135.1.65706 WP_002210135.1.65718 WP_002210135.1.6581 WP_002210135.1.66118 WP_002210135.1.66546 WP_002210135.1.66616 WP_002210135.1.67404 WP_002210135.1.67850 WP_002210135.1.6791 WP_002210135.1.68361 WP_002210135.1.68371 WP_002210135.1.68855 WP_002210135.1.69018 WP_002210135.1.69316 WP_002210135.1.69951 WP_002210135.1.70117 WP_002210135.1.70171 WP_002210135.1.70319 WP_002210135.1.70377 WP_002210135.1.70417 WP_002210135.1.70726 WP_002210135.1.7083 WP_002210135.1.7169 WP_002210135.1.71744 WP_002210135.1.72280 WP_002210135.1.72440 WP_002210135.1.72486 WP_002210135.1.7402 WP_002210135.1.74131 WP_002210135.1.74310 WP_002210135.1.74577 WP_002210135.1.74738 WP_002210135.1.75169 WP_002210135.1.75173 WP_002210135.1.7518 WP_002210135.1.75208 WP_002210135.1.75337 WP_002210135.1.75407 WP_002210135.1.75636 WP_002210135.1.75821 WP_002210135.1.76555 WP_002210135.1.76670 WP_002210135.1.77295 WP_002210135.1.77387 WP_002210135.1.77429 WP_002210135.1.77569 WP_002210135.1.77691 WP_002210135.1.78004 WP_002210135.1.7841 WP_002210135.1.78556 WP_002210135.1.7939 WP_002210135.1.79515 WP_002210135.1.79550 WP_002210135.1.79609 WP_002210135.1.79825 WP_002210135.1.79981 WP_002210135.1.8009 WP_002210135.1.80331 WP_002210135.1.81848 WP_002210135.1.81877 WP_002210135.1.8210 WP_002210135.1.82133 WP_002210135.1.82151 WP_002210135.1.82270 WP_002210135.1.82436 WP_002210135.1.82619 WP_002210135.1.8303 WP_002210135.1.83039 WP_002210135.1.83265 WP_002210135.1.83630 WP_002210135.1.8420 WP_002210135.1.84720 WP_002210135.1.85269 WP_002210135.1.85270 WP_002210135.1.8559 WP_002210135.1.85802 WP_002210135.1.86034 WP_002210135.1.86059 WP_002210135.1.86413 WP_002210135.1.87107 WP_002210135.1.8728 WP_002210135.1.87418 WP_002210135.1.8762 WP_002210135.1.87853 WP_002210135.1.87988 WP_002210135.1.88362 WP_002210135.1.88472 WP_002210135.1.89359 WP_002210135.1.89542 WP_002210135.1.8964 WP_002210135.1.90176 WP_002210135.1.9051 WP_002210135.1.90624 WP_002210135.1.91263 WP_002210135.1.91373 WP_002210135.1.91844 WP_002210135.1.92030 WP_002210135.1.92331 WP_002210135.1.927 WP_002210135.1.9311 WP_002210135.1.9320 WP_002210135.1.93623 WP_002210135.1.93928 WP_002210135.1.93933 WP_002210135.1.94052 WP_002210135.1.94201 WP_002210135.1.94545 WP_002210135.1.94683 WP_002210135.1.95746 WP_002210135.1.95981 WP_002210135.1.97245 WP_002210135.1.97375 WP_002210135.1.97448 WP_002210135.1.97791 WP_002210135.1.97864 WP_002210135.1.97872 WP_002210135.1.97894 WP_002210135.1.99109 WP_002210135.1.9941 WP_002210135.1.99416 WP_002210135.1.99788 WP_002210135.1.99882 WP_002210135.1.99972 WP_002210135.1.99990 YP_002348448.1.25044 gi|170022777|ref|YP_001719282.1| gi|186896989|ref|YP_001874101.1| gi|51597798|ref|YP_071989.1| gi|384127579|ref|YP_005510193.1| gi|108813603|ref|YP_649370.1| gi|22124052|ref|NP_667475.1| 1yy7_A 1yy7_B 187410.y0132 214092.YPO3561 229193.YP_3815 273123.YPTB3506 360102.YPA_3742 377628.YPN_3443 386656.YPDSF_0336 502800.YPK_0526 502801.YPTS_3691 gi|45443546|ref|NP_995085.1| gi|108809733|ref|YP_653649.1| gi|294505316|ref|YP_003569378.1| gi|384138587|ref|YP_005521289.1| gi|384123783|ref|YP_005506403.1| gi|145597652|ref|YP_001161728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]