SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294505332|ref|YP_003569394.1| from Yersinia pestis Z176003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294505332|ref|YP_003569394.1|
Domain Number 1 Region: 153-283
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.18e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 25-82,109-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000164
Family Thioltransferase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294505332|ref|YP_003569394.1|
Sequence length 313
Comment transferase [Yersinia pestis Z176003]
Sequence
MGRWWRYKWITFHPSLTTTDGQAGPQGKGGFNAEAHRYHLYVSLACPWAHRALLMRTLKG
LESLISVSVVHPLMQENGWTFSSDFPAATGDALYHLDYLYQLYLRAAPDYSGRVTVPVLW
DKQQQTVVSNESADIIRMFNNAFDDVGAKAGDYYPTALRNDIDDINGWVYDQVNNGVYKA
GFATTQEAYDEAVGTLFSALDRLEQILGQHRYLTGNQLTEADLRLWTTLVRFDPVYVTHF
KCDKRRISDYPNLYGFLRDIYQMPGIAETVDFAHIRTHYYRSHGTSILMGLSLSAHSKTC
WSHMIGRIALYKN
Download sequence
Identical sequences gi|384127563|ref|YP_005510177.1| WP_002229646.1.10105 WP_002229646.1.101305 WP_002229646.1.101928 WP_002229646.1.12463 WP_002229646.1.14063 WP_002229646.1.15605 WP_002229646.1.17135 WP_002229646.1.17873 WP_002229646.1.18640 WP_002229646.1.19739 WP_002229646.1.21486 WP_002229646.1.21879 WP_002229646.1.23271 WP_002229646.1.2640 WP_002229646.1.26960 WP_002229646.1.2726 WP_002229646.1.31496 WP_002229646.1.32343 WP_002229646.1.32446 WP_002229646.1.33937 WP_002229646.1.35538 WP_002229646.1.36088 WP_002229646.1.37863 WP_002229646.1.39066 WP_002229646.1.40134 WP_002229646.1.46545 WP_002229646.1.46686 WP_002229646.1.47387 WP_002229646.1.48722 WP_002229646.1.4997 WP_002229646.1.50010 WP_002229646.1.50093 WP_002229646.1.51293 WP_002229646.1.51588 WP_002229646.1.51934 WP_002229646.1.52158 WP_002229646.1.52819 WP_002229646.1.53838 WP_002229646.1.53953 WP_002229646.1.54951 WP_002229646.1.55194 WP_002229646.1.59102 WP_002229646.1.59431 WP_002229646.1.5957 WP_002229646.1.59635 WP_002229646.1.60437 WP_002229646.1.62342 WP_002229646.1.64142 WP_002229646.1.64786 WP_002229646.1.64910 WP_002229646.1.65400 WP_002229646.1.65718 WP_002229646.1.66616 WP_002229646.1.68361 WP_002229646.1.69018 WP_002229646.1.69316 WP_002229646.1.70171 WP_002229646.1.71744 WP_002229646.1.77387 WP_002229646.1.77429 WP_002229646.1.7841 WP_002229646.1.78556 WP_002229646.1.80331 WP_002229646.1.81848 WP_002229646.1.81877 WP_002229646.1.82151 WP_002229646.1.8303 WP_002229646.1.8420 WP_002229646.1.84720 WP_002229646.1.8559 WP_002229646.1.86034 WP_002229646.1.87418 WP_002229646.1.87988 WP_002229646.1.8964 WP_002229646.1.9311 WP_002229646.1.9320 WP_002229646.1.94683 WP_002229646.1.97448 WP_002229646.1.97791 WP_002229646.1.97894 WP_002229646.1.99109 YP_008479728.1.25044 gi|537470192|ref|YP_008479728.1| gi|294505332|ref|YP_003569394.1| gi|384123799|ref|YP_005506419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]