SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|408676975|ref|YP_006876802.1| from Streptomyces venezuelae ATCC 10712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408676975|ref|YP_006876802.1|
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Cgl1923-like 4.84e-88
Family Cgl1923-like 0.0000656
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|408676975|ref|YP_006876802.1|
Sequence length 396
Comment hypothetical protein SVEN_1256 [Streptomyces venezuelae ATCC 10712]
Sequence
MIELEGVPELIDPVMVAAFEGWNDAGDAASTAVAHLDREWKGEVFAALDAEDYYDFQVNR
PTVFLENGVRKITWPTTRLSVVRVGGEKPRDLVLVRGIEPSMRWRSFCNELLAFAHELGV
EMVVILGALLGDTPHTRPVPVSGVTSDPDLARTMDLEETRYEGPTGIVGILQEACTHAGV
PAVSLWAAVPHYVSQPPNPKATLALLNRLEDLIGLRIPLGELPEDARAWQVGVDQLAAED
SEVAEYVQTLEEARDTAELPEASGEAIAREFERYLRRREPGTGPGGPGVAMEGGDTAFLR
DPGSGRTRPPKPEQPGPEAVPGAESETPGDAGEPDAPEGTEGTEDTEGTDAPEGAADESP
GTGPEPGAETEPEPEPRADTEPGADTEPGADGESGK
Download sequence
Identical sequences F2RE03
gi|408676975|ref|YP_006876802.1| WP_015032461.1.22668 WP_015032461.1.41968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]