SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|408678168|ref|YP_006877995.1| from Streptomyces venezuelae ATCC 10712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408678168|ref|YP_006877995.1|
Domain Number 1 Region: 201-479
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-40
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 
Domain Number 2 Region: 637-738
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000258
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|408678168|ref|YP_006877995.1|
Sequence length 868
Comment serine or threonine protein kinase [Streptomyces venezuelae ATCC 10712]
Sequence
MSGETGVVSCQRPSCEGSYEDMGGGELYCDTCGLAPVVAPGGLIGGAPTGVAVPGRGTGT
GTGRGSGVGGPDSGSARSGSRASSRASSRSSTSRRSVSGRLSRSLSGASTSRSVSVRSSG
SSSGQSARNRLGAGLVTIPEVPRPDPRAAVMENPEVPERKRFCSRSDCGAPVGRSRGERP
GRTEGFCTKCGHPYSFVPKLRGGDIVHGQYEVAGCLAHGGLGWIYLAVDRAVSDRWVVLK
GLLDTGDQDAMAAAISERRFLAEIEHSNIVRIYNFVEHLDQRTGSLDGYIVMEYVGGKSL
KEIANDRRTPDGRRDPLPVEQACAYGIEALEALGHLHSRNLLYCDFKVDNAIQSEDQLKL
IDMGAVRRMDDEESAIYGTVGYQAPEVAEVGPSVASDLYTVARTLAVMTFDFQGYTNVFV
DSLPDPDNIEVFRTYESFYRFLVRATDPDPARRFASAQEMAEQLTGVLREVVALQSGRPR
PALSTLFGTEVRVTDTTLFAELTEDVSLLGARRRGRKQTAPPAGPPAVPPAVPATGQPAV
PPAGQPAVPAAGQPAGLAESLAPLDAPATALALPVPRVDPGDPNAGFLAGLAAAAPGELL
AALQAAPAPSAELLLRTLRAQLELGDLPAAAHTLAGLEQRDPDDWRVVWYRGVTSLVTGD
HEHAALAFDAVYDAFPGEPSPKLALGICAEVLGQLDNAAEYYRLVWATDPSFVSAAFGLA
RVRLAAGDRAGAVRTLESVPEASIHYTAARVATVRARLRRRPAWEPLGADLTAAAAQVSA
LQGFGLDAVRRERLSTEVLGTALDWVLSGSPGAEPGGGTLLLGSELDERGLRFGLERSYR
VLARLAQQGEERIELVERANRFRPRTWV
Download sequence
Identical sequences F2R2I7
WP_015033654.1.22668 WP_015033654.1.41968 gi|408678168|ref|YP_006877995.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]