SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291616990|ref|YP_003519732.1| from Pantoea ananatis LMG 20103

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291616990|ref|YP_003519732.1|
Domain Number 1 Region: 40-238
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-40
Family Nuclease 0.08
Further Details:      
 
Domain Number 2 Region: 280-480
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.85e-33
Family Polyphosphate kinase C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|291616990|ref|YP_003519732.1|
Sequence length 517
Comment hypothetical protein PANA_1437 [Pantoea ananatis LMG 20103]
Sequence
MPSAWLMCNRRWHTLAPGGIIINDSMIQGIFMTEAFDLPQSPSRQSWLEERLVPLCLHHP
GLSGIHPLSDGLDAFAARYLLMEKAAKTLDIQYYIWQNDMSGRLLFSAMLEAANRGVIVR
LLLDDNNTPGLDDTLAQLNHHPNITVRLFNPFSFRTLRALGYLTDFARLNRRMHNKSFTA
DGVTTVVGGRNIGDEYFGTGNEPLFADLDVLAIGSVVNEVAEDFERYWNSKPVSPLSEVL
DQPMSAHPDVALPPEWRESETVQHYLQRLNKSSLIDQLTQDDLPFVWAKTRLLSDDPRKG
LGKARRKSLLPQRMMEVIGAPQHQFDIISAYFVPTRAGVAQLLAMKRKGVKIAVLTNSLA
ANDVSIVHAGYAKWRKKLLRHGISLFELKPQAGLNDTPHDRGLTGNSGSSLHAKTFSVDE
KILFIGSFNFDPRSAVLNTEMGLVIESEKLAAETHQRFSDSMRDRAWTLRLDKWGRVNWL
EYPGEAQQVVHKHEPGCSWWQRLQVRLVWRLPIEWLL
Download sequence
Identical sequences D4GC01
gi|291616990|ref|YP_003519732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]