SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|499075363|ref|YP_007970841.1| from Mycobacterium avium subsp. paratuberculosis MAP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|499075363|ref|YP_007970841.1|
Domain Number 1 Region: 65-134
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 5.89e-26
Family Iron-dependent repressor protein, dimerization domain 0.000013
Further Details:      
 
Domain Number 2 Region: 130-229
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 6.87e-24
Family FeoA-like 0.0000103
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000938
Family Iron-dependent repressor protein 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|499075363|ref|YP_007970841.1|
Sequence length 229
Comment iron-dependent repressor and activator IdeR [Mycobacterium avium subsp. paratuberculosis MAP4]
Sequence
MNDLVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLHVAGDR
HLELTDKGRALAVAVMRKHRLAERLLVDVIRLPWEEVHAEACRWEHVMSEDVERRLVKVL
NNPTTSPFGNPIPGLLDLGVGPESGAEEANLVRLTELPSGAPVAVVVRQLTEHVQGDIDL
ISRLKDAGVVPNARVTVETGPAGVTIVIPGHENVTLPHEMAHAVKVEKV
Download sequence
Identical sequences D0EFQ3
WP_003878619.1.10000 WP_003878619.1.101064 WP_003878619.1.1614 WP_003878619.1.17915 WP_003878619.1.1994 WP_003878619.1.22949 WP_003878619.1.26008 WP_003878619.1.27804 WP_003878619.1.29527 WP_003878619.1.35606 WP_003878619.1.37369 WP_003878619.1.37642 WP_003878619.1.40837 WP_003878619.1.42281 WP_003878619.1.4542 WP_003878619.1.45459 WP_003878619.1.45501 WP_003878619.1.56366 WP_003878619.1.57704 WP_003878619.1.59922 WP_003878619.1.646 WP_003878619.1.66027 WP_003878619.1.66905 WP_003878619.1.6888 WP_003878619.1.76287 WP_003878619.1.78145 WP_003878619.1.81101 WP_003878619.1.81559 WP_003878619.1.8174 WP_003878619.1.82097 WP_003878619.1.82175 WP_003878619.1.82859 WP_003878619.1.83216 WP_003878619.1.86896 WP_003878619.1.88396 WP_003878619.1.89157 WP_003878619.1.9350 WP_003878619.1.98852 gi|499075363|ref|YP_007970841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]