SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407461570|ref|YP_006772887.1| from Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407461570|ref|YP_006772887.1|
Domain Number - Region: 4-29
Classification Level Classification E-value
Superfamily RING/U-box 0.00138
Family RING finger domain, C3HC4 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407461570|ref|YP_006772887.1|
Sequence length 57
Comment hypothetical protein NKOR_00095 [Candidatus Nitrosopumilus koreensis AR1]
Sequence
MDAKCPECEKVAILDDKITNVRCPHCNFEADYDTYIEIMKDQAINMSSEYIPDRPGL
Download sequence
Identical sequences K0B4Y5
gi|407461570|ref|YP_006772887.1| WP_014962338.1.70052 WP_014962338.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]