SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407462333|ref|YP_006773650.1| from Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407462333|ref|YP_006773650.1|
Domain Number 1 Region: 198-242
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000277
Family Ovomucoid domain III-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407462333|ref|YP_006773650.1|
Sequence length 250
Comment hypothetical protein NKOR_04090 [Candidatus Nitrosopumilus koreensis AR1]
Sequence
MKTRNKILLGVGIVIAIIVLLSSLMAYFNKNGTILESDYNNDPSRVLAHCAQQKYGEEND
WKTPDGKNFAVTSIGLFAMNETHYIDNNLCTWIERPSGLNTMLSGDELKFYKQKLAKDKD
ESKSCPDGQNYNEILFKCVVSCEDDLVYNGYTDSCTTEFELKYHGFCDDEFTYDPLSHIC
YSDDGTLQTPLKDPPRTAPPEPECSIQCLVYDPVCGVDGITYACGIEDAACHGVKVKHDG
ECSDSKLGTE
Download sequence
Identical sequences K0B3N7
gi|407462333|ref|YP_006773650.1| WP_014963095.1.70052 WP_014963095.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]