SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407462842|ref|YP_006774159.1| from Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407462842|ref|YP_006774159.1|
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily RING/U-box 4.59e-22
Family Zf-UBP 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407462842|ref|YP_006774159.1|
Sequence length 85
Comment zinc finger UBP-type protein [Candidatus Nitrosopumilus koreensis AR1]
Sequence
MTTECNHFVEEKKGITPNTVSCEECEKEHLPVVAIRMCLTCGHVGCCDSSIGKHATKHFE
ETGHPVMKAIPGDIWKWCYHHKEYY
Download sequence
Identical sequences K0B7W0
gi|407462842|ref|YP_006774159.1| WP_014963600.1.70052 WP_014963600.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]