SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|190575258|ref|YP_001973103.1| from Stenotrophomonas maltophilia K279a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|190575258|ref|YP_001973103.1|
Domain Number 1 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-48
Family Ribonuclease PH domain 1-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 298-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.39e-47
Family Ribonuclease PH domain 1-like 0.0000228
Further Details:      
 
Domain Number 3 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.35e-27
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 144-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.51e-27
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 609-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-23
Family Cold shock DNA-binding domain-like 0.00022
Further Details:      
 
Domain Number 6 Region: 553-630
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 7 Region: 238-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 4.71e-16
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|190575258|ref|YP_001973103.1|
Sequence length 702
Comment polynucleotide phosphorylase/polyadenylase [Stenotrophomonas maltophilia K279a]
Sequence
MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTAVAAKSAREGQDFFPLTV
DYQEKFYAGGRIPGGFFKREGRATEKETLISRLIDRPIRPLFPEDYKNDVQIIATVMSLN
PDVDGDIPALIGASAALALAGTPFMGPIGAAKVGYKNGEYILNPTVSELADSQLELVVAG
TSNAVLMVESEAALLSEEVMLGAVTFGHREMQKVINAINELTVEAGTKPSTWEAPAKNDA
LISALKEAIGPRLGEAFQVRDKLQRRDAISAIKKDVFETLAGRVAAEGWNPAELSKEFGE
LEYRTMRDSVLDTKVRIDGRALDTVRPIAVKTGVLPRTHGSSLFTRGETQAIVTITLGTA
RDGQVIDAVAGEYKENFLFHYNFPPFSVGECGRMMGPKRREIGHGRLAKRGVLAVMPSLE
AFPYTIRVVSEITESNGSSSMASVCGSSLALMDAGVPVKAPVAGIAMGLVKEGERFVVLS
DILGDEDHLGDMDFKVAGTAEGISALQMDIKIEGITEEIMKQALQQAKAGRLHILGEMAH
GLTAPREELSDYAPRLLTIKIHPDKIREVIGKGGSTIQAITKETGTQIDIQDDGTIVIAS
VNAIAAQAAKARIEQITSDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLVHVSQISSDRV
EKVGDVLKEGDVVKVKVLEVDKQGRIRLSMKAVEEGDAASAE
Download sequence
Identical sequences B2FN86
gi|190575258|ref|YP_001973103.1| WP_012480876.1.7336 522373.Smlt3385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]