SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186680675|ref|YP_001863871.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186680675|ref|YP_001863871.1|
Domain Number 1 Region: 19-156
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 1.77e-17
Family Hypothetical protein TT1808 (TTHA1514) 0.026
Further Details:      
 
Weak hits

Sequence:  gi|186680675|ref|YP_001863871.1|
Domain Number - Region: 139-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00388
Family SPRY domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186680675|ref|YP_001863871.1|
Sequence length 228
Comment hypothetical protein Npun_R0128 [Nostoc punctiforme PCC 73102]
Sequence
MTASVEYIPVAPIEYPDEDGKPMAEGDIQCSYLTYARNVLRIYFQNHPDVYVAGNLFIYY
EKGYPESVVAPDVFVVFGVENRDRRSYKTWEENNQTPDFVLEITSKATRSKDQGAKKGIY
AFLGVREYFQYDPTGDYLNPQLQGLHLVDGNYFPVGTNTLADGTVYLPSEVLGLELRLEA
GKLRFYNPTTSQTLLTHEEEASARQATEEKAQRLAAKLRELNIDPDSL
Download sequence
Identical sequences B2J3J8
WP_012406957.1.44837 gi|186680675|ref|YP_001863871.1| 63737.Npun_R0128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]