SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186680948|ref|YP_001864144.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186680948|ref|YP_001864144.1|
Domain Number 1 Region: 837-1203
Classification Level Classification E-value
Superfamily ARM repeat 6.24e-26
Family Leucine-rich repeat variant 0.099
Further Details:      
 
Domain Number 2 Region: 741-889
Classification Level Classification E-value
Superfamily ARM repeat 3.45e-20
Family PBS lyase HEAT-like repeat 0.02
Further Details:      
 
Domain Number 3 Region: 256-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000651
Family Extended AAA-ATPase domain 0.07
Further Details:      
 
Weak hits

Sequence:  gi|186680948|ref|YP_001864144.1|
Domain Number - Region: 141-308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00425
Family ABC transporter ATPase domain-like 0.064
Further Details:      
 
Domain Number - Region: 289-315,524-647
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0779
Family Nucleotide and nucleoside kinases 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186680948|ref|YP_001864144.1|
Sequence length 1206
Comment signal transduction protein [Nostoc punctiforme PCC 73102]
Sequence
MLDWLAIWGVTQAAGLIFKPILEDLAKDAAKDWAKDLLKGIPGKIVQKLKKEDIEIAAGK
ALKEFLQLMQQQLKVRCKLAETEIKEYTTDIQKFISDKSVAELLGKAFDINCESLDAKTL
EDSWNRLQLKPLPSKFNWQSITEQYFTQVQELLLDSKELHHILELQKLSDIEINTKEIAG
VIVDFNLVKYQEGIRERYGNLKLDSLDTSGYAYNELKLWRIFTAQNVRETHQVLPQVHEL
PKEHLRRLRESEQVEAVELEELERHKRVYFEQPIRSVLDVVNKKQDYKYIVILGDPGSGK
STLLQFLALNWAESPLDNVISLPIPLLIELRTYMRRREDKECNNFLEFFHQCSGAVHHLN
QLEVDKQLKAGNALVMFDGLDEVFEPGKREDVITDIHRFTNDYPDVQVIVTSRIIGYKPQ
RLLNAEFRHFILQDLDSEQIQDFINRWHELTFTDAVDKVRKQERLQRGIEASKSIAELAG
NPLLLTMMAILNRNQELPRDRATLYDQASRVLLHQWDVERVLIEDKRLDPKTIDYKDKQA
MLRQVAYLMQTGDKGLAGNLINENDLVKVLTDYLKTIEFDKPREVAKVMINQLRTRNFML
CFLGADYYAFVHRTFLEYFCAWEFVWQFKETQTLTIEELKNEVFGKHWQDESWHEVLLLI
TGMIEAKFVGEILDYLIVQDGEEEKFVNLFLAAKCLVEVRNRAAIASIAIQLLNQLKDLT
KYDLWYYYDPRLYGAETELVQEIRTQAVTAIATTWQESLNTKTWLKERATQDDDNDVRRA
AVEELANHFKDDPDTKSWLKERATQDDDNDVRRAAVEELANHFKDDPDTKSILKERATQD
DHENVRSAAVEGLAENFKDDPDTKSILKEHAIQDDHEDVRCAAVEGLAKNFKDDPDTKPI
LKEHATQDDHENVRSAAVEGLAENFKDDPDTKSILKERAIQDDDWYVRSAAIRELAKNFK
DDPDTKAWLKQIANHDDDRLVRGAAVDELAKNFKDDPGTKAWLKQCATQDDDSVVRSAAI
RELVKNFKDSDTKIWLKQLANYDDDSVVRSAAIRELAKNFKDDPDTKTWLKQCATQDDNY
LVRSTAAHELAKNFKDDPETKSILKELATKDDDNDVRGAAVQELAKNFKDDADLFDIYYQ
CAVNDPFKGSHESYISNPRRIALEIIIKQYPQHPQTLPLLRDRAENDPDEQVREFAQKKL
AQLSNN
Download sequence
Identical sequences B2J6Z3
63737.Npun_F0422 gi|186680948|ref|YP_001864144.1| WP_012407227.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]