SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186681298|ref|YP_001864494.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186681298|ref|YP_001864494.1|
Domain Number - Region: 134-197
Classification Level Classification E-value
Superfamily TrpR-like 0.00732
Family SPO1678-like 0.028
Further Details:      
 
Domain Number - Region: 15-61
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0429
Family MRR-like 0.064
Further Details:      
 
Domain Number - Region: 51-87
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0897
Family Glycosyl hydrolase family 7 catalytic core 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186681298|ref|YP_001864494.1|
Sequence length 225
Comment hypothetical protein Npun_R0812 [Nostoc punctiforme PCC 73102]
Sequence
MHHTKDKGDLAAAKVIADLVEKEYSVFVPVVTEHAPFDLIAYKNGKCYRIQAKYSCDGTL
KNKSNWADKNGCHEKKYKSDDFDFYGLYLPDINKVVYPSIKFGGCGIRTTPPKSPNPFYW
WEDFTDLTEVALKRTYKEFGVDLTTRKVNPDSRIHTRKVERPSKEELGKLVWEKPTAQIG
RDFGVSDKAVEKWCKAYGVEKPPRGYWVKKAYGKMEVQLTIHDED
Download sequence
Identical sequences B2IT53
WP_012407573.1.44837 gi|186681298|ref|YP_001864494.1| 63737.Npun_R0812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]