SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186681628|ref|YP_001864824.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681628|ref|YP_001864824.1|
Domain Number 1 Region: 11-218
Classification Level Classification E-value
Superfamily ARM repeat 8.86e-42
Family PBS lyase HEAT-like repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186681628|ref|YP_001864824.1|
Sequence length 226
Comment HEAT repeat-containing PBS lyase [Nostoc punctiforme PCC 73102]
Sequence
MTALSLQEISTQLESPNLRDRMVALANLRHVSPEQAVPLIKKVLDDESLQLRSMAIFALG
IKPTPECYSILVRILENDPDYGIRADAAGALGYLGDARAFEVLSRAFYEDTDWLVRFSAA
VSLGNIKDPRARQILLQALDSKEVVLQQAAISALGEIKDIESVDQILRFAQSDDWLVRQR
LAEALGNLPTPKSVSALKYLEKDNHFNVAEAARIGLKKLEEIGDQA
Download sequence
Identical sequences B2IWD6
gi|186681628|ref|YP_001864824.1| WP_012407902.1.44837 63737.Npun_R1155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]