SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186681639|ref|YP_001864835.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681639|ref|YP_001864835.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000149
Family 7-Fe ferredoxin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186681639|ref|YP_001864835.1|
Sequence length 74
Comment 4Fe-4S ferredoxin [Nostoc punctiforme PCC 73102]
Sequence
MPHTIVTEVCEGVADCVDACPVACIHDGPGKNAKGTDWYWIDFATCIDCGICLQVCPVEG
AILAEERPELQKTP
Download sequence
Identical sequences A0A1E2WPB7 B2IWE7
WP_012407913.1.26765 WP_012407913.1.44837 63737.Npun_F1166 gi|186681639|ref|YP_001864835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]