SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186681878|ref|YP_001865074.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186681878|ref|YP_001865074.1|
Domain Number 1 Region: 1301-1609
Classification Level Classification E-value
Superfamily DNase I-like 1.73e-30
Family Sphingomyelin phosphodiesterase-like 0.048
Further Details:      
 
Domain Number 2 Region: 911-1028
Classification Level Classification E-value
Superfamily CalX-like 8.63e-20
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 3 Region: 208-339
Classification Level Classification E-value
Superfamily CalX-like 9.02e-20
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1976-2132
Classification Level Classification E-value
Superfamily beta-Roll 1.05e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.00093
Further Details:      
 
Domain Number 5 Region: 1624-1712
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000183
Family Cadherin 0.01
Further Details:      
 
Domain Number 6 Region: 1821-1910
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000011
Family Cadherin 0.027
Further Details:      
 
Domain Number 7 Region: 423-597
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.00000034
Family Thermostable phytase (3-phytase) 0.024
Further Details:      
 
Domain Number 8 Region: 725-850
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.0000419
Family Lamin A/C globular tail domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|186681878|ref|YP_001865074.1|
Domain Number - Region: 631-725
Classification Level Classification E-value
Superfamily Cadherin-like 0.000334
Family Cadherin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186681878|ref|YP_001865074.1|
Sequence length 2156
Comment outer membrane adhesin-like protein [Nostoc punctiforme PCC 73102]
Sequence
MALTQGDIAFISFNADEDGWSIVTFVDIDPNTTIYFTDNEAISTTAFNTGESYFQWTSGS
STINAGTVIRFSAVDVATLSASVGTLSRATVSGSSNYGLSASGDVIYAFVGSSAAAPTTI
LTAVSSGDVVTPGDPITNAGLTVGVNAIVLRTSADYGEYSGSRTGQSSFANYKSSVFNVN
NWTVDQIDGNYTTTAPNTTNFTIAASTPTVTIAAQDANAAETGTDPGTFRISRTGSTTDA
LTVNYTIATGAGQATSADYTPTLTGTAIIAAGESFADITITPVDDQTVEGTETVTLTLNS
STNYTFGATASATVAIADNDTAVTSIDLSTYVRIGRYDLPEPTRTNPPLNSLLAQEASAV
TYNKDTDTLFVVGDGGRAIVQVSKTGQLIDSMTLASGSSPQGTEFYDTEGLTYVGDGKFV
LIEERDRQANLFTYAPGTTLTRSNVQTVKLGTTVGNIGIEGISYDPQTGGFIAVKEITPE
GIFQTNIDFAAGTASNGSPTTVNSTNLFDPALAGLADFADVFALSNLSALNGQPNSSHLL
ILSQESGKIVNIDRTGNISSSLTIVSDAGNPLSVVDQGNEGITVDKNGLIYIANENGGGD
IDHPQLWVYAPSSFTYTNQAPVAVSLANTVTSLSESTSIATPFKVGNIIVSDDALGTNTL
SLTGADANSFEITGNGLFLKAGTTLDFETKTSYNVSVNVNDTTVGSNPDATTAFTFSVTD
VNENPTTSGIFITEVAPWSSGNSPVAADWFELTNTGTSAVDITGWKIDDNSNSFATSVAL
SGITSIGAGESVIFIEGATVNPTFLSNWFGANPPAGLKIGNYSGSGVGLSTSGDAVNIYN
ATGALQANVIFGASPTASPFATFDNAALSNNATIATLSAVGVNGAFSVVNTLNNLSVVEI
GSPGTIVSSLPTIAIAATDANAAEALQDPGTFRISRTGSTTNALTVNYTIAAGAGQATSA
DYTPTLTGTALIAAGQSFVDITITPVDDSLVEGTETVTLNLSSSANYTLGTATATVAIAD
NDVAPTLIHDIQGSGSTAALTGTQTIEGIVTRAFLGSTKLNGFYVQEEDADADNNAATSE
AIFVFDPSGKFTGNVGDKVRITGTAKEFTTTSGGNTSSLTELDITSGTVNNLGASTLPTV
TNVQLPVTNVSDLERYEGMLVNLSAGSGNLTVTEYFQLGRFGEVLLSATGSSNQSGTDAR
LDQYTQFNAPSVSGNSAYLADIAKRRIYLDDGSGTQNPDPILFGRDGNPLSASNTLRGGD
TVASITGILDDRFEGYRIQTTTGVNFTPTNPRPVTPPNVGGTLKVASFNVLNFFNGNGTG
GGFPTSRGAENLIELNRQRNKIIQAIVTSGVDVVGLEELENDGYGSTSAIQDLVNGLNAV
AGAGTYSFINPGTSLATDEITVGLIYKSGKVTPVGAAATLTTSAAFNLVGRQPLAQTFGQ
NSNGEQFTVVVNHFKSKGSSSGGVGDADAGDGQGFSNGTRTRQAQDLAAWLATKPTGTND
TDYLVVGDLNSYAKEDPLTTLAGAGYNNLLPDTSYSYVFDGQVGSLDHALATSSLAAQVS
GAEKWHINADEPSVLDYNTNFKSAGQISSLYNADQFRASDHDPVLVGLNLVSTNNAPTNL
TLSPSSTNENVAANTVIGTFSTIDPDTGNTFTYSLVAGTGDTDNTAFAIADNTLKIKASP
NFETKSSYSIRVRSTDNGGLSFDKVLTIQINDVNEAPTAVVDTINVAEDATTLNLRSILL
SNDTDPDAGDTKNIIAVNTTGTKGTVTFNPTTQNLTYAASSFNSLAQGQTATDSFSYAIA
DSKGLQSTAIVNVSVTGVNDAPTVVQPLEDRIISTSKLFSFNVGDKFTDIDRGDTLTYTA
TGLPTGSDIANTGLIFGNISQAGIFAVTVTAADGKGGSVSDTFDLTVANNKATSSNDIIF
IDQLVGVSVLNALGGNDRVIGTDANETLSGGAGNDYIDAKGGNDSLLGNDGIDTLLGGAG
NDILEGGAADDILLGELDNDTLLGGGGNDSLNGGAGNDNLNGGADNDTLLGGLGNDILVG
GGGNDHLIGWGGGTNEIDQLNGAQSADTYILGDASSVFYAKSGNGDYADIVSFKASDRIQ
LKGSADNYFLGSASVSGFSSSSVGIFANNGTQLELIAVVESGLNRNLSTDTRFVFV
Download sequence
Identical sequences B2IZK1
63737.Npun_F1424 gi|186681878|ref|YP_001865074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]