SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186682132|ref|YP_001865328.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186682132|ref|YP_001865328.1|
Domain Number 1 Region: 29-159,207-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.02e-48
Family Filamentous hemagglutinin FhaB, secretion domain 0.0064
Further Details:      
 
Domain Number 2 Region: 341-507
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000126
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Weak hits

Sequence:  gi|186682132|ref|YP_001865328.1|
Domain Number - Region: 548-598
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0366
Family Obg GTP-binding protein N-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186682132|ref|YP_001865328.1|
Sequence length 815
Comment filamentous hemagglutinin outer membrane protein [Nostoc punctiforme PCC 73102]
Sequence
MSRYRSSWYWELGIVSTLAIAGVLTFFESFVLAQIQKDGTLESESSIITPKLIDGQLIDQ
IDGGAVRGTNLFHSFEQFSVSAERTAYFNNAIDIQNIISRVTGNSISKIDGILKANGTAN
LFLINPNGIIFGPNASLNIGGSFVASTASSLNFADGTKFSATSPQAKPLLTLSVPIGLQF
GATAAPIRNQSQASPDGTVDIFGQGVGLQVQRGKTLALIGGDITLEGGNITARAGKVELG
SVAGNSLVSLSPTNQGWVLGYEGVQNFQNIEIIQLNKIPSIVDTHGNGSGNIHLQGGLVR
VAASFLILVNPFGVQSGGNLTVNASDSVVIEKDSQLFTQSFSNANSGNINVNTKKLVVKS
GAQLQGQLTINASDSVELISGTNIPLFQDGSDLISSGLFSATSGDKNAGNIIINTGRLRI
EGGARISTSSEGIYRFITNQLTPATGNAGNLTVNASESVELIGTSPNGSKLSSLFSGTQG
PGDGGNLTLTTGQLIIKDGAAINVSSQARKNVIYIGDPNNLGKAGDLNIIARSILLDNKG
KLISNSESGKGGNITLQVQNLLLMRRESQITTNAGTTGLGGDGGNIIINAPNGFIVATPL
GNNDITANAFSDSGGKITITAKNIFGFVPRTRADVEKLDREEINPNNLRTSDITAFSQQN
PSLNGTVRINSPDVDPSQGLVELPVNLVDASQQIVAGCNSGGKIAKSSFITTGRGGIAPN
PTEPLIADDAVLADWIALSPDSPNHAEGIQKRVVVDKQRNTEENSQKVNSVNEPTQIVEA
QGWVVDANGNVVLVAQVPTASPHNSSLMATSCAGN
Download sequence
Identical sequences B2J1M4
63737.Npun_F1714 gi|186682132|ref|YP_001865328.1| WP_012408403.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]