SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186682299|ref|YP_001865495.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186682299|ref|YP_001865495.1|
Domain Number 1 Region: 115-202,235-439
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.26e-29
Family Pectate transeliminase 0.068
Further Details:      
 
Domain Number 2 Region: 364-639
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000426
Family Pectate lyase-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186682299|ref|YP_001865495.1|
Sequence length 640
Comment hypothetical protein Npun_F1899 [Nostoc punctiforme PCC 73102]
Sequence
MIKTLRSLLSYAALTTIALVAVVTTQLGTMQKTPAIANITPTVIHSFNSSNKSDGSTSEA
ESVQNSDGKLYGTRYGGGANDKDLIFRVPPNDSNFNLFYLFREKYGQRTNPKIAATQSTT
SLYVYVSPTGSDTGGDGSLGKPLRTLAYAAKRVQPNQNYTIYLNAGVYRETEATVLPPGV
NIEGAGESSVTITSNSAIPAPGINTGSTDWSLLHYGSIIQLVSPSYSGSSPRYGAPSEMV
EATDGNQTLSGFTIDGNGKTIKAGVWVENRNNVTMHNVTFKDFQHSGAVFTRGNMWWFVP
LPEGKWMKNTTIYDCTFINSAADGVSGGSTGNLRLGGLDGAAIYNITIRENKGYGIKFMH
VGHLRNVKIHDCDIQVPEVDSQWSEDASIELWNLSYGNEIYNVTSNTWLSMVNHAVMNDY
QPTATHPSNLKMRNVRIKDIDGQSVKESIEVALSGVEISNSYFQDKGFGIAIWGGKAWGG
SIENHNINIHNNIFANVARKVQFGFGNSAAVFIPDSASNIKIHNNVFDTLGNSLQLDSAD
KISIKNNVFLNSQGDDVQGGNNIAFTNNLRRNTNPAKPTWQIRFAANATNIQGDPRFTGT
GDRWNTYYKAASSRSLVVDRGTNVGLPYSGSAPDIGRWEW
Download sequence
Identical sequences B2J3T1
WP_012408567.1.44837 gi|186682299|ref|YP_001865495.1| 63737.Npun_F1899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]