SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186682389|ref|YP_001865585.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186682389|ref|YP_001865585.1|
Domain Number 1 Region: 121-198,326-520
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000127
Family iota-carrageenase 0.082
Further Details:      
 
Weak hits

Sequence:  gi|186682389|ref|YP_001865585.1|
Domain Number - Region: 8-59
Classification Level Classification E-value
Superfamily LysM domain 0.000122
Family LysM domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186682389|ref|YP_001865585.1|
Sequence length 573
Comment peptidoglycan-binding LysM [Nostoc punctiforme PCC 73102]
Sequence
MTCKIGSSYKIKSGDTLFIIAERELGDGDHWREILNPNGIPFTEKEAENLQTGQEICIPN
GSVPPTGEWQSKRVFFGSNGKLTYTSDKEQNRIPDYSYAGYRYGEVKLPNVPEVSSISPI
SGDNTAHIQKALDAVATRQPDANGFRGALVLKPGVYELRSTIQIKASGVVLRGSGDGSDR
TQDTILVAKVVDKPIVQGKQDRPTDKSVVILGTNNPAPWKSGDETKITDDFVQVGSLKFN
VENASLFKTGDAIIIKHPSTQKWIDALDGGGVGEVDDPDKNPWKPGKVDIVYYRRVDRVE
GNKIILDAPIYNHLDRKLSQSIVCKINSSEVLTNVGLENLRIEIDKGGEDEKSLWSAVSV
IGAEDAWVRNLTALHFGFSGVYTEGALRVTVTDVKAFDPIAIRTGGRMYNFNTEKHSQLI
LFQNCEATNGRHNFISNGTSSASGIVFHKCKSKGLGSNSADNSDSEGHRLWTQAMLFDSI
DENSPDTGSIALINRGNFGSGHGWAAAHSTIWNYNGTIIVQKPPTAQNYAVSSTGKVQKK
FKFSGAIGNVEGEKGKLSPASLYEAQLKERLQH
Download sequence
Identical sequences B2J4Y2
gi|186682389|ref|YP_001865585.1| WP_012408653.1.44837 63737.Npun_R2010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]