SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186682539|ref|YP_001865735.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186682539|ref|YP_001865735.1|
Domain Number 1 Region: 350-687
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-47
Family Patatin 0.0000614
Further Details:      
 
Domain Number 2 Region: 9-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.65e-28
Family Laminin G-like module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186682539|ref|YP_001865735.1|
Sequence length 698
Comment patatin [Nostoc punctiforme PCC 73102]
Sequence
MINLVNTQTVLTFDGEKDYIDFGRNDIGGVFAQGSSAFTVSGWVNPHELTNKATSYGTRN
VFFARSSERYSDNFEFGISETGSLDVYIDESVSKGIKTFGQGELTIGQWHFFAIVFNSSQ
LTVYLDDREYSDSLRGLSLNKATSSITLGATLHKQVYFKGQLANISVWNYPCTQAQIQTH
RCGLIAGDEEGLVAYWKLDEGQGTTVKNQTGKSYQGNFRGNPIWTLAEIPFATQSSNPVP
FVGELSNQEDIKEEIQTETAVIPEENISPLTTNLLAATVSLVSDDENQPKKIQQTGINSE
ESEIIPTAIALSPHDEETKTHQAEDPVNIQQAQILTQEESVEAMNTKAHPKYKILSIDGG
GIRGIIPALLLAEIERRTQKPIFSLFDLITGTSSGGILALGLTKPRLSSDVSDNLPVAEY
TAEDLLQLFLEYGVEIFYEPLFERLLGPLEDIFLQPKYPSEGKEEIFRQYFGNAPLENNL
KEVFVTSYDLEQRIPIFFTNQPEKQQIESKNFQKLCGGFSLLDAALATSATPTYFAPHRL
VNPHNSGIAYTLIDGGVFANNPAHLAILEAQISSKRKAQKVLNTEDILVVSLGTGSLTSV
YPYKEVKNWGLLQWGRPLLNIMFDGGSEVVAGELEQLFEPSDQEAKSFYYRFQTLLDSEL
EEIDNTKLQNTRQLQAIAHRLISNKSQQIDEMCSLLLG
Download sequence
Identical sequences B2J692
63737.Npun_F2191 gi|186682539|ref|YP_001865735.1| WP_012408793.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]