SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683067|ref|YP_001866263.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186683067|ref|YP_001866263.1|
Domain Number - Region: 287-369
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.0451
Family TolA 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186683067|ref|YP_001866263.1|
Sequence length 503
Comment hypothetical protein Npun_F2787 [Nostoc punctiforme PCC 73102]
Sequence
MSYVSLFKNIPELLSQPIGIAAIASLGIHGAIAMIVPLMPMDSSKPKDTASSKSVGLLEL
SQADQSRLPESTPKIGLQQLPPIAPLSASNFSAQAGLPPLAAPPSGSQLVLPPLPPSSNN
YRVSSLPTRQSLRMIPSDNLRFDASKFDNSKFNSSPKFTPSVPRVNVTDTKYEASKPLDV
NRLPVLQSQQIPNDILQNAQSQNPSNTNLITPVQGNITPQITQPVNNASKPMAQNQLINS
LKQAPRAGDSLTLIRGTTSQAPDFSGKGTELAIAQLDSYANLRKEVQQQYPNAEQKPVIR
QTLPTDKPNLQGSVLGVLVVDPDGKVLDIRFQDKLVSPELQLKAREYFNKQSPKGDKRVS
SYPFNLNFQNSTSNSTGTTPLSTPGINNNQLIPLPAATSKPFPDLRIRNNQIAPSSTSIL
KPLAAPRVNGNQPVLTPAATPKPLSELQIRNSLTPSSVANTSEPLVLPRVNKIQVTPSTE
SDKKLVERLREVKENRDKSNPEK
Download sequence
Identical sequences B2IVD5
WP_012409313.1.44837 63737.Npun_F2787 gi|186683067|ref|YP_001866263.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]