SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683264|ref|YP_001866460.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683264|ref|YP_001866460.1|
Domain Number 1 Region: 22-360
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.59e-54
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186683264|ref|YP_001866460.1|
Sequence length 364
Comment filamentous hemagglutinin outer membrane protein [Nostoc punctiforme PCC 73102]
Sequence
MSSLSGWVALFGIAIVSVSTFSWNCANAQITSDGTLPTNSSIQKESNTFNIRGGTQSGGN
LFHSFGEFSVPTGNTAIFNNAADIQNIISRVTGNSISNINGLITANSTANLFLINPNGIV
FGQNARLDIGGSFLASTASSLKFADGFEFSAINPQSVPLLSINVPVGLQYGANPGNILNQ
SQAFDSSGEIVGFQVKPEKTLALVGGDVVIEGGFLVAPSGRIELGSVAGNSFVSLKPNDT
GYTLGYKGIENFKDIHLTQEAFVATDGDSGGSIQVQGANVILADGSQISAVTLGEGTGKG
LTVNATQSLQLIGTSADGLYSSGLFSSTYGTGANGNLTINTRDLLIRDGAVVRAGTFAAG
KGGT
Download sequence
Identical sequences B2IXI9
WP_012409504.1.44837 63737.Npun_F3012 gi|186683264|ref|YP_001866460.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]