SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683265|ref|YP_001866461.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683265|ref|YP_001866461.1|
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000286
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186683265|ref|YP_001866461.1|
Sequence length 356
Comment filamentous hemagglutinin-like protein [Nostoc punctiforme PCC 73102]
Sequence
MTVTADSVQLIGTSTDGLYPSALFTSSDNGTTGDAGNLTIDTRDLLIRDGAQVSAGTSGE
GKGGNLSLTADFVELIGISANGRASSGLFASAVGTGKAGDLLITTQQLLISNGAVATVSS
RGEGTTAGNIVISANSVRLDNGQITAQTLSGNGGNLNFNIADLLMRHGSKISTTAGTAQS
GGNGGNMKIDSRYIIAIPEENSDITANAFTGTGGKVEINSQGIFGIESRTKPTEKSDITA
SSELGVSGVINIKAPDTSSIQNSFTELPPVIDTNALIANSCISRGTKRQENSFTITGSGA
LTPNRPGVLVSNYTTGEVRGVETTSRPWKKGDPIIEPTGLYRLNNGQLLLSRECSN
Download sequence
Identical sequences B2IXJ0
63737.Npun_F3013 WP_012409505.1.44837 gi|186683265|ref|YP_001866461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]