SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683392|ref|YP_001866588.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683392|ref|YP_001866588.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000422
Family PBS lyase HEAT-like repeat 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186683392|ref|YP_001866588.1|
Sequence length 172
Comment hypothetical protein Npun_F3189 [Nostoc punctiforme PCC 73102]
Sequence
MDLAATSLSLIATERHLKSLLSILSISSDPIQRNSVVYAISFLSNYQGNQEVISTLTEVA
ANIAEAPFIRAQALEGIGNKLSHELPENLYQPAVNVIIQGLDDTEAEVRFWSCFAAGALE
IKETLPKLQLLAQTDKTIVAGWWSVGEEAEDSVTLMTGGEPPLRKPYNLPTN
Download sequence
Identical sequences B2IYR2
gi|186683392|ref|YP_001866588.1| WP_012409625.1.44837 63737.Npun_F3189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]