SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683403|ref|YP_001866599.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683403|ref|YP_001866599.1|
Domain Number 1 Region: 50-161,208-373
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.54e-40
Family Filamentous hemagglutinin FhaB, secretion domain 0.0049
Further Details:      
 
Domain Number 2 Region: 512-633
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000223
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 3 Region: 373-503
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000289
Family Filamentous hemagglutinin FhaB, secretion domain 0.066
Further Details:      
 
Domain Number 4 Region: 832-960
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000298
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 5 Region: 634-765
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000534
Family Filamentous hemagglutinin FhaB, secretion domain 0.079
Further Details:      
 
Weak hits

Sequence:  gi|186683403|ref|YP_001866599.1|
Domain Number - Region: 959-1044
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000138
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186683403|ref|YP_001866599.1|
Sequence length 1275
Comment filamentous hemagglutinin outer membrane protein [Nostoc punctiforme PCC 73102]
Sequence
MSHICWHWMKNIKVAICLALIETLVISSGERTCAQSKIVPDNTLNIESSKVINNSDGLPI
ENIDGGAQRGINLFHSFREFNVGEGKAVYFTNPAGIENIISRVTGSDRSEILGKLGVLGK
ANLFLINPNGIIFGKNAILDVKGSFVATSANAIKFGNQGFFSASSPETPLLLTIKPSALF
FNQIGAGPIENNSIASAGVDGANNPVVGLRVADSQSLLLVGGNVLNTGGLNALGGRVELG
GVASQGEIGLNLNNQSLTFPDEVVRGDISLREAFVNVAGDSGGAIALHGKNIDISEGSSL
NAGIAAGLGTPTTTVGDISLNATQAISISQSSSVTNQVSPNATGNSSNINIQAGSLNLTG
GSQLSSRTLGQGNSGNILVDVSGAITVDGEDSSTSPSRIINQVQPSGVGNSGDINLKSES
LKITQGGYLSASTLGRGNSGDIFVDVSDAVTLDGENSSTSPSRIMSLVAPSAIGDGGDIN
LKARSLILTQGGTVTASTLGKGNSRNIFVDVKGAISLDGVNSNGIPSLIANQVQSSAVGN
GGDINIKADSLTLTRGGLISGSTLGRGNSGNIFVDVKGSVTLDGKDSFRFVSGIRSAVSP
SAIGNSGDINIKAESLSLTQGGFVDTGTFGEGNSGNISVDVGSAVTLDGVVSNSENYPSR
ISSQILPSAVGNGGDINIKAESLSIIHGGTLNTAIFGEGNAGNISVDVKGAVILDGVDSG
GFGGTITSQVTSSAIGDGGDINIKAESLTLKQGVSLSATTFGEGNSGNISVDVKGAVILD
GVDSDGVGSAIFSEVESSAVGNGGDINITAESLTLGQVNQLSSSTSGRGNAGNISVDAKG
AVILDGVDSNGFGSAIFSQVESSAIGDGGDINVKANSLNLTRGGSLNARTLGNGNAGNVS
VDVRGAVRVDGEDSNGFGTGITTEAESSAIGNGGDINIKADSLALAQGGIMSASTFGQGN
GGNIQIDLMMPNSKLTLSDKAAIAASTSEQGKGGNIEIEAFDSVNLTNDSEISVNSKGQG
NAGDLRITTGSLTLRRQSDLLADTVSSEGGNIQLQVRDILLLRNNSSISTTAGQEGAGGN
GGNIDINTKFLVAVPKENSDITANAFEGKGGLIKITTQGIFGIEKRENLTPLSDITAFSQ
QNPLLDGEIVINIQNADIRKELVALPTNLVDVSGLISQGCAASRVSTNQPESQFIVTGRG
GLPPQPGEALRVPAIAVDENPINTAKQNQSPDVASTPPLEANSWRFDGQGRVILTASATS
EASSFGIKPGICHGN
Download sequence
Identical sequences B2IYS3
gi|186683403|ref|YP_001866599.1| 63737.Npun_R3203 WP_012409635.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]