SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186683569|ref|YP_001866765.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186683569|ref|YP_001866765.1|
Domain Number 1 Region: 194-419
Classification Level Classification E-value
Superfamily EndoU-like 1.11e-36
Family Eukaryotic EndoU ribonuclease 0.022
Further Details:      
 
Weak hits

Sequence:  gi|186683569|ref|YP_001866765.1|
Domain Number - Region: 107-135
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0194
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186683569|ref|YP_001866765.1|
Sequence length 425
Comment hypothetical protein Npun_R3406 [Nostoc punctiforme PCC 73102]
Sequence
MSKLAFTLKVSTGAVILLTLCVTSANSTTISEGFESGTKTSYADADVNLSTGLWNLNDAL
IGDLSTDRKNGAKSARIRNSGRVTMRFDRTTGAGSITIKYAKFGTDANTTWGVWCSTNSG
SSWIQIGSTVNTTSTALQTATFTPNISGSVRCEIRKTDGTANRTNIDDIIINDYGSSGST
SPSLPAGSVPLFDDINNPVSGLAYGSPADVTPSAPALNSFDTAVVNLCSVPGTVVSRTGF
QSMMQNNPTVLANIKAYVGGYLKVGRTSDTDFLNDLTNLWFNVAGFDHVFCGEPVQGGSI
GGLHFVGRYVELQNKGLAGRLNNNTFREEVVPNTVYTMGVVMKVGTGTAQSTIKGYPYTL
NAEEILSNASLGYKNNPNTSTTNQACLLGITDENRTFQAVFVRRQGGIRTFYPDATPDAT
PNCIQ
Download sequence
Identical sequences B2J0X1
gi|186683569|ref|YP_001866765.1| WP_012409798.1.44837 63737.Npun_R3406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]