SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186684110|ref|YP_001867306.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684110|ref|YP_001867306.1|
Domain Number 1 Region: 80-376
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.33e-41
Family Pectate transeliminase 0.037
Further Details:      
 
Weak hits

Sequence:  gi|186684110|ref|YP_001867306.1|
Domain Number - Region: 599-629
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.0418
Family Sporulation related repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186684110|ref|YP_001867306.1|
Sequence length 633
Comment hypothetical protein Npun_F3983 [Nostoc punctiforme PCC 73102]
Sequence
MIHYHVFPKYRRVDIMLAKLKFLESARLLFFSLSVLSFTVGMGATSLTFLSSALAELAGG
IAQMPSTPNSAPLGETKNSQANVLFVNSNGGNDSAGNGSESAPVKTITHALQLANPNTVI
MLSTGTYSAETGEEFPLMLKPGISIQGNPSNQGKDIIIQGGGDYLSRSFGGQNVTIVGAN
QALLTGVTVTNPNRRGYGLWIESSDPVIAENTFTGSTQDGISVSGNAAPTISKNYFDRNG
ANGITIAGNSSPQVKENVFHQTGFGINIAQNAAPIVIGNQIQNNRSGIVVQAKAHPILRN
NIIQDNKEDGLVAIAQAMPDLGSASEPGGNQFQNNARYDINASAAKQMISAGGNNLVSDR
ITGKVDINGTIALAAQNSQSTPNNVLREVPPTGEITFSAPEISETTNRQNSNSISANNPI
STQLNSQLLPLVPAKVPLSTLVSNQQQPTSKVAGFPTPSSLSARQIPTNTQIATSSPAQP
PNTPQLNYVRIDPNMIEFTAPEYPSNSVASTRNQTQQPLPILEATAPNASALLPLPDRNI
PIGNTRNMQTSSASIPYGGKSATQFGIRYRVVVPLLTDRDQDLVRSLAPGAFPTVWEGQR
VMQAGVFSSEYNAKEMLKTLSSNGLRAIMEPLN
Download sequence
Identical sequences B2J6F8
WP_012410330.1.44837 63737.Npun_F3983 gi|186684110|ref|YP_001867306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]