SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186684183|ref|YP_001867379.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684183|ref|YP_001867379.1|
Domain Number 1 Region: 51-421
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.65e-43
Family Pectate transeliminase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186684183|ref|YP_001867379.1|
Sequence length 674
Comment S-layer protein [Nostoc punctiforme PCC 73102]
Sequence
MVSKGLILSTSLAIPVVLILLTQGEKIKVSLVENAPHVSTNNEISLSSNKLISANSTPKT
YYVSGNGNDKNNGLSTSSAFRTIQKAADLTNPGDTVLVMNGVYKNVAKALSAVSIKRSGT
ANAWIRYKAYPGHFPKIQHNTWNGILISSGASYIEINGLEVIGNNANITLDYAMSEKNNR
QNPLTSGNCINVDGRTNGHVHHIRILNNKVHDCGGTGISAMQSDYVTVDNNVVFNNAWYG
VYGSSGISMLNNWNSDKNQGYKMFVTNNKTYNNRMYIPWIAVGKITDGNGIIIDTTRNDQ
NNSKLGAYQGRTLVKNNLTFNNGGSGIHTFLSEHVDIVNNTAVLNNQSPEIDGGQIFANV
SSDVRILNNILYAYPGKEVNSNNKNKNVVYDYNIYLNSSKVSVKGPHDIVADSQILKKYP
TLEKISNDWISRLDKQNPPTRTYVESNSAGLLCESVTYSFQGKPTQVGCSPLSLAQIAFS
DVSSNYWAAQFIQQLSQRGVIAGFPDGRFRPEEPVTRAQFAAMVNKAFPKSQQRQAINFA
DVPSNYWAYSAIGQAYTIGFLSGYPGNRFQPNQAIPRQQVLVSLANGLGYTSGGNTENTL
KYFNDASNIASYARRPIAAATQKQIVVNYPNVKSLNPTATATRAQVAAFIYQALVSSNQA
SAINSPYVVSNPSN
Download sequence
Identical sequences B2J7J1
NYSGXRC-10360s gi|186684183|ref|YP_001867379.1| 63737.Npun_R4058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]