SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186684767|ref|YP_001867963.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186684767|ref|YP_001867963.1|
Domain Number 1 Region: 47-114
Classification Level Classification E-value
Superfamily PGBD-like 4.45e-20
Family Peptidoglycan binding domain, PGBD 0.0062
Further Details:      
 
Domain Number 2 Region: 230-377
Classification Level Classification E-value
Superfamily ARM repeat 1.2e-17
Family Clathrin adaptor core protein 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186684767|ref|YP_001867963.1|
Sequence length 380
Comment peptidoglycan binding domain-containing protein [Nostoc punctiforme PCC 73102]
Sequence
MRLCRSSILIFTCFSCVGFYPNRASTATPNLAPEILEVAQASSTVTASPAVLRYGSRKSD
VQRLQTQLKQLGYYNGVVDGQYNPSTEIAVAEFQKAKGLKVDGLAGLATRRRLQAALVAK
NQIITSPIVTFPNPTPKPTAKPKPPEKGFIWWFICSIGVLGTIGALIYLMRWFRQIKQMQ
KSEISDTKRLSEANKKTMIPPPPETVTGKETATPPLSTRLLLPEKTSRLAKLNIVDELIQ
DLRSSDPTKRRKAIWDLGQQGDSRAIQPMVDLMIDADSQESSLILAALAEIGIRTLKPMN
RGLAISMQDESPQVRQNAIRDLTRIYDMMGQMSQMLRHALDDPDAEVQATARYALTQMNR
MRGLPEQQGLPEDSHNDARE
Download sequence
Identical sequences B2IXW1
WP_012410980.1.44837 63737.Npun_R4663 gi|186684767|ref|YP_001867963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]