SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685112|ref|YP_001868308.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186685112|ref|YP_001868308.1|
Domain Number - Region: 13-78
Classification Level Classification E-value
Superfamily ARM repeat 0.0214
Family MIF4G domain-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186685112|ref|YP_001868308.1|
Sequence length 115
Comment hypothetical protein Npun_F5022 [Nostoc punctiforme PCC 73102]
Sequence
MVFNPDFLNDNSEEHPNQLLSDHAEEYPNQLLKYLQHQSPDVLARIAQSASPEIKQIISQ
NVQGLVGMLPAENFNVQITTDRDNLAGLLASAMMTGYFLRQMEQRMQLEHLSNGQ
Download sequence
Identical sequences B2J1D4
368175 WP_012411319.1.44837 63737.Npun_F5022 gi|186685112|ref|YP_001868308.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]