SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685143|ref|YP_001868339.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685143|ref|YP_001868339.1|
Domain Number 1 Region: 49-277
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3e-65
Family DNA/RNA non-specific endonuclease 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186685143|ref|YP_001868339.1|
Sequence length 279
Comment DNA/RNA non-specific endonuclease [Nostoc punctiforme PCC 73102]
Sequence
MKKIKIFKFLLPFVTVVLFIIGLAQIVPAQSSVSVHLTLGNPSGAGTSSQNNYLLVKPQY
VIGYNCSLGRPNWVSWQLNSSWLGSTPRQDTFRADTTLPSGCYQVQSTDFSGSGFDRGHM
TPSADRTSSVTNNSATFLMSNMIAQAPDNNQGIWASLEDYARTLVGQGKELYIISGGYGM
GGTGSNGTFYTIANGRVQVPNRTWKILVVLNTPGSGLAGVTTSTRVIAVNIPNAQGVRTA
NWRNYRVSVDSLESLTGYNFLSQVSTSIQSVIEAQVDNL
Download sequence
Identical sequences B2J210
WP_012411350.1.44837 gi|186685143|ref|YP_001868339.1| 63737.Npun_F5059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]