SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685218|ref|YP_001868414.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685218|ref|YP_001868414.1|
Domain Number 1 Region: 59-233
Classification Level Classification E-value
Superfamily ARM repeat 0.00000806
Family Clathrin adaptor core protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186685218|ref|YP_001868414.1|
Sequence length 265
Comment hypothetical protein Npun_R5139 [Nostoc punctiforme PCC 73102]
Sequence
MAQASSSWQQLINQIPNWNWSHPLFKTKGATKQQTFKRFSGPGGFLGFLTIVVAMLLWNW
MLLLALLMGIGVMVLVYSMQKWDWQLHWSKIRKFLNSSNRRLVLAVISGGLATVSTYMAA
AIWVDSHSSWIAAGAIIQGVGTLLTLILLVWQIVNFYENREEDYLDRLLVNLTDKDPLKR
LIALRQLTKFISRQRVDSSVQQDVAECLQLLLSREEEVAIREAAFKSLQACDRLQSVGDH
RLQVLPPKTAAPFVPISAKVKHHVY
Download sequence
Identical sequences B2J285
gi|186685218|ref|YP_001868414.1| 63737.Npun_R5139 WP_012411424.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]