SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685529|ref|YP_001868725.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685529|ref|YP_001868725.1|
Domain Number 1 Region: 91-238
Classification Level Classification E-value
Superfamily GUN4-like 7.72e-57
Family GUN4-like 0.00000114
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily ARM repeat 4.03e-27
Family GUN4-associated domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186685529|ref|YP_001868725.1|
Sequence length 242
Comment GUN4 domain-containing protein [Nostoc punctiforme PCC 73102]
Sequence
MTDPMILSGPANDIDSLRRPLMAGSEKVQQQIIPQLAELGNEGLDVLMEFLLKRRENPAT
WVDGKAYQVLYNSDAPQAKEFLRSSFPEGIVPLKSECGINYNSLQQLLAAQDFQAADRVT
IEKMCELSGTTAVQRKWLYFTEVENTSAVDLQTINNLWLVHSEGKFGFSVQREIWLSLGK
NWENFWPKIGWKAGNNWTRYPNGFTWDLSAPRGHLPLSNQLRGVRVFASLLSHPAWSKNP
EK
Download sequence
Identical sequences B2J5Q0
63737.Npun_F5475 WP_012411728.1.44837 gi|186685529|ref|YP_001868725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]