SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685540|ref|YP_001868736.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685540|ref|YP_001868736.1|
Domain Number 1 Region: 21-87
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 6.54e-22
Family TTHA0281-like 0.055
Further Details:      
 
Domain Number 2 Region: 86-124
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000233
Family Arc/Mnt-like phage repressors 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186685540|ref|YP_001868736.1|
Sequence length 126
Comment hypothetical protein Npun_R5486 [Nostoc punctiforme PCC 73102]
Sequence
MKTLNQKNQQIEKPSLEYYLNLQYSIILYPDPEGGYVAQIKDLPGCLTQGETLEETVANL
NEARELWIETAYEAGDDIPLPSSNDSYSGKLLLRMPKSLHRRLAETSEREGVSLNQYIVS
LLSAVT
Download sequence
Identical sequences B2J5R1
WP_012411739.1.44837 63737.Npun_R5486 gi|186685540|ref|YP_001868736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]