SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|186685602|ref|YP_001868798.1| from Nostoc punctiforme PCC 73102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186685602|ref|YP_001868798.1|
Domain Number 1 Region: 15-312
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.58e-64
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186685602|ref|YP_001868798.1|
Sequence length 320
Comment Ycf48-like protein [Nostoc punctiforme PCC 73102]
Sequence
MCIGCSKVPSVSYNPWKVISVPTDSNLLDIAFTNNPEHGYLVGSNATLLETNDGGNSWKP
ITLQLDEQKYRFDSVSFAGKEGWIAGEPGLLLHTTDEGASWSRIPLSEKLPGSPIAVKAL
ADNTAEMATNVGAIYKTTDGGKNWKAQVESAVGVVRNLERSADGKYVAVSAKGSFYSTWE
PGQDAWVPHNRNSSRRVENMGFGDNGQLWLLARGGQVQFSDPTKPEEWQEAKYPELSTSW
GLLDLAYRTPEEIWVGGGSGNLLRSADGGKTWEKDRDIEEVAANLYKIVFLEPERGFIIG
DRGVLLKYLPNPEITSPEAA
Download sequence
Identical sequences B2J6S9
63737.Npun_F5550 gi|186685602|ref|YP_001868798.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]